KEGG   Trichoderma reesei: TRIREDRAFT_33949Help
Entry
TRIREDRAFT_33949  CDS       T02991                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tre  Trichoderma reesei
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRIREDRAFT_33949
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TRIREDRAFT_33949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 83 aa AA seqDB search
AFRGPKGALRHSRHLCRKMGIVAGGTGVTPTFQIIRTICERGRGTAQLGLIYANRTEEDA
LLRQEPDRFVKPYQGIFKDYYCL
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gctttcagaggccccaagggagcgttgcggcactcacgccacttgtgcaggaagatgggg
atagtagctggcgggacgggcgtcacgcccacgttccagatcatcaggaccatctgcgaa
aggggccgcggcaccgcccagctcggccttatttacgccaaccggacagaagaggacgct
cttctacgacaggagccggatagatttgtaaagccttatcaagggatcttcaaggattac
tactgtctt

DBGET integrated database retrieval system