KEGG   Trichoderma reesei: TRIREDRAFT_51562Help
Entry
TRIREDRAFT_51562  CDS       T02991                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tre  Trichoderma reesei
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIREDRAFT_51562
Enzymes [BR:tre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TRIREDRAFT_51562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 726 aa AA seqDB search
MDDEAVRTPPASGTLKAVQIADPVPEDYIEDDSHHAKQRRGHAAAPPSRRLSGRLSATAS
PALRPVDDATLSGHHHHHRRNHQSERILAQVGEWLERERKKAAARKLKPRRRKSKSPPSD
QTQAAEGAAAPASSQSPRERSGSTSSQSSDISFDGLEHILRTSMASIGLTSLPKFSPRVG
NKPRRPPSRTSLQRAASSDTDYVDGDAIVPSCDAWLDNSKTMSYTGGASISTDDVATQVT
KVEKEREAWTIFKNEILRIAHTLRLKGWRRIPLGSGEALSVERLSGALTNAVYVVTPPAD
MPQLEGKKPPTKVLLRVYGPQVEHLIDRENELQVLQRLARKKIGPRLLGTFKNGRFEQFF
NAQTLTPTDLREPETSRQIAKRMRELHDGVEVLLHERESGPGVWKNWDQWVDNVGRITSF
LDQELEKTPEAARKDSLVHGWKANGYVCGVPWEQFKEMVNKYRAYLNNCYKGHGSIRDRL
VFAHNDTQYGNILRIRPDDEKSPLLQPANKHKQLVVIDFEYAAPNTAGLEFANHFTEWMY
NYHDPLVPWACNPDRYPSLEQQKRFIKAYVEHRPYSQHSNSTPRLTPIDSQAASGSATPS
LHPTASSSSIVDFMLDARYPGGDWNAVEKAREEQVDQQVRELIEEARLWQPANSAQWIAW
GIVQAKVPGLDGMAANEELGADDFDYLSYAQDRAMFFWGDVVQLGLVKLEELPEALRARI
KLVKYQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaggctgtgcgcactccgcctgctagtggcacgctgaaagcggtgcagatt
gccgaccccgtccccgaggactacatcgaggacgattcccaccatgcgaagcagcgccgg
ggccacgcagcggctcctccctctcgtcggctcagcggcaggctgtctgccactgcgtcg
ccggccttgcgccctgtggacgatgcgactctctcgggacaccaccatcaccaccgtcga
aaccaccagagcgagaggatcctggcccaggtgggagaatggctggagcgcgagcgcaag
aaggcagccgccaggaagctgaagccccgtcggcgcaagtccaagtctcccccgtccgac
cagacacaggccgcagaaggcgccgcggctccggcttccagccaatctccgcgcgagcga
tcgggttccacgagctcgcagtccagcgacatctcctttgacggcctggagcatatcctg
cgaacatcaatggcgtccatcggactcacttcgctgccaaaattcagcccgcgagttggc
aacaagccccggcggccgccttcgcgaacgtcgctccagcgcgctgcttcctcggacacg
gactatgtcgacggcgacgccattgtgcccagctgcgatgcctggctggacaattccaag
acgatgagctacacgggaggagccagcatcagcacggacgatgtagccactcaagtcacc
aaggtcgagaaggagagggaggcatggaccattttcaagaatgagattctacgcatagcc
catactctgaggctcaagggctggcgcaggatcccactaggcagcggcgaggccctgtct
gttgagcgactgagcggtgctctgacaaacgccgtctatgtcgttacgccgccagccgac
atgccccagctggagggcaagaagccgccgaccaaggtgctgcttcgcgtttacggaccg
caggtggaacacctcattgatcgggagaacgagcttcaggtgctgcagcgacttgcgcgc
aagaagattggtccgcggctgctggggaccttcaagaatgggcgcttcgagcagttcttc
aatgcccagacgctgaccccgacggatctgcgagagcctgaaacgtcgaggcagattgcg
aagcgtatgcgagagctgcacgatggtgttgaggtgctgctgcacgaacgagagagcggg
cccggcgtgtggaagaactgggaccagtgggtagacaatgtcggccgcatcaccagtttc
ctggatcaggagttggagaagacgcccgaagctgcccggaaggactctctcgttcatggg
tggaaggccaacggctatgtgtgcggcgtcccctgggagcagttcaaagagatggtgaac
aagtatagagcctatctcaacaactgctacaagggccacgggtccatcagggaccggctc
gtgttcgcacacaacgatactcaatacggcaatatcctcaggatccgccccgacgacgaa
aagtcacccctccttcagccggcaaacaaacacaagcagctggttgtcattgactttgaa
tatgcggcccccaacaccgccgggcttgagtttgccaaccatttcaccgagtggatgtac
aattaccatgacccgctggtcccttgggcctgcaaccccgaccgctacccaagcctcgag
cagcaaaagcggttcatcaaggcctacgtggaacaccgcccctattcccagcactccaac
tcaacgcctcgcctgacgcccatcgacagccaagccgccagtggctcggccacgccttcg
ctccacccaacggcgtctagcagctcgattgttgactttatgctcgacgcccgctacccc
ggaggtgactggaacgcagtggaaaaggcgcgcgaggagcaggtcgaccagcaggtacgg
gagctcatcgaggaggcccggctgtggcagccggccaacagcgcccagtggatcgcctgg
ggcattgtgcaggccaaggtgccgggtctggacggaatggctgccaacgaggagcttggc
gccgacgactttgactacctgagctatgcccaggacagggccatgtttttctggggagat
gtggtgcagctggggctggtcaagttggaggagctgcccgaggcgttgcgagcgaggatc
aagcttgtcaagtatcaataa

DBGET integrated database retrieval system