KEGG   Trichoderma reesei: TRIREDRAFT_55245Help
Entry
TRIREDRAFT_55245  CDS       T02991                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tre  Trichoderma reesei
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRIREDRAFT_55245
Enzymes [BR:tre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TRIREDRAFT_55245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 317 aa AA seqDB search
MARPRITVLGSLNIDLVSYVPHHPLPGETLTANHFNTSPGGKGANQAVACGKLSRSSDLS
NPAADVSMIGAVGSDTYGQQLISSLTSYGVDTSAVAVRQDGKTGIAIIIVDEPSGQNRII
LSAEANHTLLPEHFSTLPGPRPDLLIMQLEIPFDTVLQALRTANASGIPVLLNPAPAKTL
PDEAYQNLAHLVVNETEAAILSGCQESDLDDVSGLERVSALFIQRGVGNVIITLGGRGVY
YATKDGKSALVPALKAEVVDTTAAGDTFVGSYALAVVSAGSGAFDIDTAIRAANRAAAIT
VSRKGAQVSIPWKDELN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctagaatcaccgtcctcggctccctcaacatcgatctcgtctcctatgtc
ccccaccaccctctgccaggcgagacgttgaccgccaatcacttcaacacctctcccggc
ggcaaaggcgccaatcaagccgtcgcttgcggcaagctctctcgctcctccgacctttcc
aacccagctgccgacgtttccatgattggcgccgttggctccgacacatacggccagcag
cttatttccagtctgacctcctatggcgtcgacacatcagcagtggcagtccgtcaagac
ggcaagacgggcatcgccatcatcatcgttgacgagccctctggccaaaaccgcattatc
ctctccgcagaggcaaaccacacccttctgccggaacacttctccactcttcccggcccc
cgtccggatctgctcatcatgcagcttgaaatcccctttgacaccgtcctgcaggcccta
cgcaccgccaacgcctctggaatccccgtccttctgaacccggcgcccgcaaagacactc
cccgacgaggcttaccagaaccttgctcaccttgtcgtcaacgagacggaagctgccatc
ctttcaggctgccaagaatccgatctcgacgatgtctccggcttggagcgggtcagtgcc
ctcttcatccaacggggcgttggcaacgtcatcatcactcttggcggccggggcgtctac
tatgccaccaaagatgggaagtcggccctggtgcctgctctcaaggctgaagtcgtcgac
accaccgccgccggcgatacatttgtcggatcctacgccttggccgtcgtcagcgctgga
tcgggcgccttcgatattgacaccgctattagagccgccaaccgggccgcagccattacc
gtctctcgcaagggggcccaagtctctatcccttggaaagatgagctgaactaa

DBGET integrated database retrieval system