KEGG   Trichoderma reesei: TRIREDRAFT_69736Help
Entry
TRIREDRAFT_69736  CDS       T02991                                 

Definition
(RefSeq) glycoside hydrolase family 30
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
tre  Trichoderma reesei
Brite
Enzymes [BR:tre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     TRIREDRAFT_69736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 476 aa AA seqDB search
MLFISVLTTIAAVGGVNAASSFASTADGRNQFTPIQAPVLNAANPGIDNWKFTIKEKTGR
KQTVKGFGAAVTDATVAAFNKLNANLRSQLLNEIMTPAGLNFNLLRHTVASSDLSADPAY
TYDDAGGKVDTGLNSFGLGDRGNAMISMLANMRKLQSNLTILGSPWSPPGWMKVKGQLIG
GGTANNKLNHAYEDAYAQYFVKYLKAYESGGAHIDAITLQNEPLNNKDDMPTMLIQQDES
GALIRDKVGPALRNAGLSTQIWAWDHNQDVYSYPQTVMNMASQYVQAAAWHCYAGNNPDN
WTPLTKFHNEFPGKDQYMTECWTAVGTTDWVHSSSFNMFPLQNWANGVIAWTLGSFTGGG
PALSGGGNCHQCTGLVTVSPDGSSYKKEIDYYMMGQFSRYIPKGAVVVDGTGSYLFPDNT
GMEAVGTINPDGTRTVVIQNRYNHDIWVQVGTESESQTWNARVPGSSVTTWILPKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgctctttatctccgtcctcaccaccattgcggcggttggcggcgtcaacgccgcctcc
tcgttcgcctccacggccgacggccggaaccagttcacgcccatccaggcgcccgtcctc
aacgccgccaacccgggcatcgacaactggaagttcaccatcaaggagaagacgggccgg
aagcagacggtcaagggcttcggcgcggccgtcaccgacgccaccgtcgccgccttcaac
aagctcaacgccaacctgcgctcgcagctgctcaacgagatcatgacgccggcgggcctc
aacttcaacctgctgcggcatacggtcgccagctcggatctctctgccgatccggcgtac
acgtatgacgatgctggcggcaaggtcgatacgggattgaacagctttgggctgggagat
cgtgggaatgccatgatcagcatgctggccaacatgcggaagctgcagtccaacctgact
attctgggatcaccgtggtcgcctcctgggtggatgaaggtcaagggccagctgattggc
ggcggcacggccaacaacaagctcaaccacgcgtatgaggatgcgtacgcgcagtacttt
gtcaagtacctgaaggcgtacgagagcggtggtgcgcatatcgatgccattacgctgcag
aacgagcctctcaacaacaaggacgacatgccgacgatgctgatccagcaggacgagtca
ggagccttgatccgggacaaggttgggcctgctctgaggaatgcgggcttgagcacgcag
atctgggcctgggatcacaaccaagacgtctactcgtacccccagaccgtcatgaacatg
gccagccagtacgtccaggccgccgcttggcactgctacgccggcaacaaccccgacaac
tggacgcccctgaccaagttccacaacgagttccccggcaaggaccagtacatgaccgag
tgctggacggccgtgggcaccaccgactgggtccacagctccagcttcaacatgttcccg
ctgcagaactgggccaacggcgtcattgcctggacgctgggctccttcaccggcggcggc
cctgcgttgtctggaggcggtaactgccaccagtgcacgggtcttgttaccgtctctccg
gatggaagcagctacaagaaggagattgactactacatgatgggacagttcagtcggtat
attcccaagggagctgttgtcgtcgatggtacgggcagctacttgttccctgataacacg
ggcatggaggccgtcggcacgattaacccggatggcacccgcacggtggtcatccagaac
aggtacaaccacgatatctgggtgcaggtgggcacggagtcggagagccagacttggaat
gctcgcgttcctggttcgtcggtgacgacttggatcctgcccaaggcttaa

DBGET integrated database retrieval system