KEGG   Trichoderma reesei: TRIREDRAFT_76954Help
Entry
TRIREDRAFT_76954  CDS       T02991                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tre  Trichoderma reesei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIREDRAFT_76954
Enzymes [BR:tre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRIREDRAFT_76954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 611 aa AA seqDB search
MAIQRSVANASSVAIRIGALLFFRAFPARLPSIIFALFAIYIPAFLTSYFSPPELEVVDD
EVDITVKETVVTPDDEPDQELVADEVDVKETISFSEKDVPAWKIIFYGAPSAKRPLSSLL
SFLINLVFVALTADALYRARWYYPADDLSFVRLGYVSHNEANFLIREPDQAKMPVTFQIR
HYNGLIWQSVGSVKATSNETDFTSVLTIPLLSYTEQQKYEWRTSNNHTGELTAAPQPGKM
PTQNGGKYTFLSTSCILPRFPYSPFDHPLAIPGLRNLAKRLPELSAQFMLFLGDFIYVDV
PERFGKSVDEYRMQYRQVYASPDWPPVGQNLSWIHVLDDHEIANDWDANSTGVYQNAVDP
WHIYQAQINPPRAVAAGTTSERRRGATWFEFVQGPASFFMLDTRSYRSSNSLPFNATEKT
MLGADQLADFLAWLARPEPKGVRWKFVASSIPFTKNWPVNVKDTWGGFLVERKKILEAMW
DVAARGIGVVILSGDRHEFAATKFPPPPESDWPEESTVYEFSTSPLNQFASPIPSYSQVD
EEDVLIQYHHSGMSKFGSFTIEEEDGESKLLYRLFISGDEKWNTTITAPPVPPEEVKHAS
SGSFWDRLRGW
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaaaggagcgtcgcaaatgcgtcctcggtcgcaataaggataggagccctt
cttttcttccgtgcttttcccgcgcgattgccgtctatcatctttgctctgtttgccatc
tatattcctgcgttcttgacgagttacttttctccgccggagcttgaagttgtggatgat
gaggtcgacatcacggtcaaggaaaccgtagtcacgccggatgatgaaccggaccaggag
ctggtcgcggatgaggtcgacgtgaaggagacgatttccttttccgaaaaggacgtgccg
gcttggaagatcatcttctacggcgcccccagtgcaaagcggcccttgagctccctgctg
agctttctcatcaacctggtattcgtggcccttacggccgatgccttgtaccgcgcccgc
tggtactatcctgccgacgacctgtcttttgtgcgcctcggctatgtctctcacaacgag
gccaactttctcatccgcgagcccgaccaggccaagatgcccgtcactttccagattcgg
cactacaacggtctcatctggcagtccgtcggcagcgtcaaggccacctctaacgagaca
gacttcaccagtgttctcaccattccgctcctgagctacacggagcagcaaaagtatgag
tggcggacctcgaacaatcacacgggcgagctgactgcggcgccccagcctggcaagatg
ccaactcagaacggaggcaaatacaccttcttgtccacgtcttgcatcctgccgcggttc
ccttactcgccctttgatcatccgctggcaattccaggtctgcggaatcttgccaagagg
ctccctgagctgagtgcgcagtttatgctcttcctgggcgacttcatctacgtcgatgtt
cccgagcgctttggaaagtcggtcgatgaatatcgcatgcaataccgacaggtatacgcc
tctccggactggccccccgttggccaaaacttgagctggatccatgtcctggacgatcac
gagattgccaatgattgggatgccaacagcaccggcgtgtaccagaacgctgtagacccc
tggcacatctaccaggctcaaatcaaccctccgcgagctgtggccgctggtacgacgagc
gagcgtcgacgcggcgccacgtggtttgagtttgtgcagggcccggcgagcttcttcatg
ctcgacacccgcagctatcgctccagcaactcgctaccctttaatgcgacggagaagacg
atgctcggcgccgatcagctggctgactttctggcttggctcgcccgacccgagcccaag
ggcgtgaggtggaagtttgtcgcctcttccatccctttcacgaagaactggcccgtgaac
gtgaaggacacctggggcggattcttggtcgagagaaagaagatactcgaagccatgtgg
gatgtcgcggcccgcgggatcggcgtcgtcatcttgtccggcgacaggcacgaatttgcc
gcaaccaagttcccgccccctccagagtccgactggcccgaggagtcgaccgtctacgag
ttttccaccagtccgctcaaccagtttgcttctccaattccttcgtacagccaggtggac
gaggaagatgtcttgattcaataccatcactccggcatgtccaagtttggctccttcact
attgaagaggaagacggcgagagcaagcttctttaccgcctcttcatcagcggcgacgaa
aagtggaacacgaccatcacagctccgccggttcctcctgaggaggtgaagcatgcttct
tcggggtccttttgggataggctcaggggttggtaa

DBGET integrated database retrieval system