KEGG   Trichoderma reesei: TRIREDRAFT_80762Help
Entry
TRIREDRAFT_80762  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tre  Trichoderma reesei
Brite
Enzymes [BR:tre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIREDRAFT_80762
Peptidases [BR:tre01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TRIREDRAFT_80762
Ubiquitin system [BR:tre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    TRIREDRAFT_80762
  UBL-specific proteases (ULPs)
   TRIREDRAFT_80762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 18489222
NCBI-ProteinID: XP_006968020
JGI: Trire2_80762
UniProt: G0RS32
Position
Unknown
AA seq 240 aa AA seqDB search
MPTEGVFIRPSGQKTFIPLENNPEVFTSLVHDLGVSPELGFYDVYSLDDASLLSTVPRPV
LALIFITPAEMYFAVRKQDGTTVSPEHLTYDKSGDDEPVLWFQQTIGHACGLMALLHSGF
FLDGLLHETTPLKPVERAAALYNNEELEKKHMKAARTGTSQPPEASEENHFHFISFVKGK
DGHLWELEGATDGPLDRGLMREGDDVLSEGALDMGIRKFLKVGNGNVNFSIVALAKKPAE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaaggcgtcttcatccgtccatccggacaaaaaaccttcatccccctggag
aacaaccccgaagtcttcacctctctggtccacgacctcggcgtctcccccgagctcggc
ttctacgacgtctacagcctcgacgatgccagtctcctctcaacggtgccacgtcccgtc
ctggcactgatcttcatcaccccggcagagatgtactttgccgttcgcaagcaagacgga
acaaccgtgtcgcccgagcacttgacctacgacaagagcggcgacgacgagcccgttctc
tggttccagcagaccattggccatgcgtgcgggctcatggcgctgcttcactctggattc
ttcttggatggccttctccacgaaactacgcctctcaaacctgttgagagagccgcagca
ttatacaataatgaagagctggagaagaagcatatgaaggccgcaaggacgggcacttcc
cagccgcccgaggctagcgaggagaatcacttccacttcatctcctttgtcaagggaaag
gatggccacttgtgggagctggagggcgccactgacggtcccttggatcgggggctgatg
cgtgaaggcgacgatgtgctgagcgagggggcgctggatatggggattcgcaagttcttg
aaggttgggaatgggaacgtcaactttagcattgtggcattggcgaagaagcctgccgag
tga

DBGET integrated database retrieval system