KEGG   Trichoderma reesei: TRIREDRAFT_82177Help
Entry
TRIREDRAFT_82177  CDS       T02991                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tre  Trichoderma reesei
Brite
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TRIREDRAFT_82177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 303 aa AA seqDB search
MSSLLEGIFPPSRQNYELLLRGWQIGYPILGSLQWVIKWYGMGKTSVASRFNIPGRIAWM
TMESPGFLTLLYVMKTLPQRAGVEDLPWQNRVLGGLFVIHYSYRAILFPLLQPSMSPIHI
GVWALALSFQLCNALCLSSWLSAYGPTTPEAWALSSSLPQFILGIGIFYLGLSSNFFHDE
ELREIRRREQKRQDRIRAQQSSSSTNNKSGAAGGSGGSGVEKHYQIPQAGLFRYILYPHY
LSEWIEWFGFWMAAGWGCAPARAFLVNEVFSMLPRAVNGKKWYVDKFGEDKIRGRWAVIP
GVV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctcctggaaggcatctttccgccctcgcgccaaaactacgaactcctcctt
cgaggctggcaaatcggatatcccatccttggctccctgcaatgggtcatcaaatggtac
ggcatgggcaaaacctccgtcgccagccgcttcaacatccccggccgcatcgcctggatg
accatggaaagcccgggcttcctgacgctgctttacgtgatgaagacgctccctcaacgg
gccggcgttgaagacttgccctggcagaacagagtcctcggcggcctctttgtcatccac
tactcctacagagcaatcctcttccccctcctccagcccagcatgtcccccatccacatt
ggcgtctgggccctcgccctcagcttccagctctgcaacgccctctgtctttcatcctgg
ctctccgcctacgggcctaccacgcccgaagcttgggctctctcatcgtccctcccgcag
ttcatcttgggcattggcatcttctacctcggtctgtcatccaacttcttccacgacgag
gaactgcgcgagattcgaaggcgggaacagaaacgccaggaccgcatccgcgcacaacaa
tcctcctcatccactaacaataagagcggtgctgctggtggtagcggcggcagcggcgtg
gaaaagcactaccagatcccgcaggcaggactcttcagatacattctctatccgcattac
ttgtccgaatggatcgagtggttcggcttctggatggctgcgggctggggctgcgccccc
gcgcgcgcgtttctcgtcaacgaagtcttttcgatgctgcctagggccgtcaacgggaag
aagtggtatgttgataaatttggcgaggacaagattcggggcaggtgggctgtcattccg
ggggttgtgtga

DBGET integrated database retrieval system