KEGG   Thermomicrobium roseum: trd_0107Help
Entry
trd_0107          CDS       T00845                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tro  Thermomicrobium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_0107 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_0107 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    trd_0107 (trpB)
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     trd_0107 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
114992..116206
Genome map
AA seq 404 aa AA seqDB search
MTTRTQPVRQLPDERGRFGEFGGMYAPVTLLPAIEELIAAYEDARRDPAFQAEFERLLRD
FVGRPTPLYYAASLTETVGGARIFLKREDLAHTGAHKINNAVGQGLLAKRMGKPRVIAET
GAGQHGVATATVCAMLGLECVVYMGELDVQRQSLNVFRMKLLGAEVRPVSSGSRTLKDAM
NEAIRDWVTNVRTTYYLVGSVAGMHPYPMIVRDFQSVIGKETREQVLAAVGRLPDAVVAC
VGGGSNAIGIFSAFLEDESVELHGAEAAGEGIETGRHAASLTAGRVGVLHGSRSFVLQDE
DGQIVEAHSIAAGLDYPGVGPEHAYLKVTGRAQYHAITDAEALAAFQLLCRTEGIIPALE
SAHAIALAVRLAKERPRDQVIVVNLSGRGDKDMQTVASALGVTL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagaacccagccagtacgacagcttcccgacgagcgtgggcgctttggggaa
ttcgggggcatgtatgcgccagtgacgctcctgccagcgatcgaggaactgatcgcggcg
tacgaggatgcccgccgtgatcctgctttccaggccgagttcgagcgattgttgcgcgac
ttcgtcggccgccccacgccactctattacgctgcgagtctgaccgagacggtgggaggt
gcccgcatcttcctcaagcgggaagacctcgcgcacaccggcgcacacaagatcaacaac
gcggtcggccagggtctcctggccaagcgcatggggaagccgcgcgtgattgccgagacc
ggtgctgggcagcatggagttgcgaccgcgaccgtctgtgccatgctcggtctcgagtgc
gtcgtgtacatgggcgaactcgacgtgcagcgtcagtcgctcaacgtcttccgcatgaag
ctgctgggggcagaagtccgaccggtcagttcgggaagccgcacgctcaaggacgcgatg
aacgaggcgatccgcgactgggtcaccaacgtgcggaccacctattatctcgtggggtcg
gtcgctgggatgcacccgtacccgatgatcgtgcgcgatttccagtcggtgatcgggaaa
gaaacgcgcgagcaggttttggccgcagtgggacgcttgcctgacgcggtcgttgcctgc
gtcggtggggggtcgaacgcaatcggtatcttttcagccttcctggaagacgagtcggtc
gaactgcacggtgccgaagctgctggagaagggatcgagaccggacggcatgcggccagc
ttgacggctggtcgtgtcggcgtgctgcatggctcgcggtcgttcgtgttgcaggacgag
gatgggcagatcgtcgaagcgcacagtatcgcggctggcctcgactatccgggggtgggg
ccggagcatgcctatctcaaggtgacgggtcgcgcgcagtaccacgcgatcaccgatgcg
gaggctctcgcggcgttccagctgctctgccggacagagggaatcatcccggccttggaa
tcggctcatgcgatcgctctggcggtgcggttggccaaggagcggccgcgcgaccaggtc
atcgtggtcaatctctccggacgaggcgataaggatatgcagacggtcgcgagtgcgctg
ggggtgacactgtga

DBGET integrated database retrieval system