KEGG   Thermomicrobium roseum: trd_0108Help
Entry
trd_0108          CDS       T00845                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tro  Thermomicrobium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_0108 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_0108 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    trd_0108 (trpA)
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     trd_0108 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116206..117036
Genome map
AA seq 276 aa AA seqDB search
MRRTSRIADAFAALRARGQLGIIPYLTIGYPQRESTLELVPALVRGGACAVELGIPFSDP
LADGVTIQRASHVALANGVTVRFCLETAARLREQGVDVPLVFMGYFNPLLQYGLERFVHA
CVEVGVDGVIVPDLPPNESDELHALCRAAGRDLIFMVAPTSTDRHLREVAARASGFVYCV
SLTGVTGARERLPDDLPAFLQRVRAVTALPLALGFGISRPEHVSQARGLVDAVVVGSALL
DRLAGEPPEGQAAAAESFIAWLRQGADAVAPVGEGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgacggacaagccggatcgctgacgccttcgcggcgttgcgtgcacgagggcaactg
gggatcatcccctatctcacgatcggctatccgcagcgggagagtacgctggaactggtt
cctgctctggtgcgtggcggagcgtgcgcagtggaactggggattcccttttccgatccg
ctggcggacggtgtgacgatccagcgggcgagccatgtcgcgctggccaatggggtgacg
gtgcgcttctgcctggagacggcagcgcggctgcgtgagcagggtgttgacgttccgctc
gtcttcatgggatacttcaatccactgctccagtatggtctggagcggtttgttcatgcg
tgtgttgaggtcggcgtcgacggcgtgatcgtgccggatcttccaccgaacgaaagcgac
gaactccacgccctctgtcgggcggccgggcgcgacctgatctttatggtggcgccgacg
agcaccgatcgacatctgcgcgaggtggccgctcgtgcgagtggcttcgtctactgcgtc
tcgctgaccggcgtgaccggagcgcgtgagcgtctgccggacgatctgccagccttcctg
cagcgcgtgcgagcagtgaccgctctcccgctcgcgctcggtttcggtatctcgcgaccg
gagcacgtgagtcaggcacgggggctggtcgatgcggtcgtcgtcgggagtgcgctgctc
gatcgcctggctggagagccaccggagggacaggctgccgcggcggagtcgttcatcgct
tggttgcggcaaggagcggatgcggtcgcaccagtcggggaggggtcgtaa

DBGET integrated database retrieval system