KEGG   Thermomicrobium roseum: trd_0332Help
Entry
trd_0332          CDS       T00845                                 

Definition
succinate dehydrogenase, membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tro  Thermomicrobium roseum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_0332
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    trd_0332
   00650 Butanoate metabolism
    trd_0332
  Energy metabolism
   00190 Oxidative phosphorylation
    trd_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(335600..336013)
Genome map
AA seq 137 aa AA seqDB search
MTIARPHLGRERPSGGFELYSWYYFRISGLLLILLAVGHVVIMHVVNTVDEIDWQFVADR
WNSPFWRVYDWLLLFLALTHGLNGARLAIDDYVRPHGWRVFAHSVLWTLALLFLVIGSIA
IVTFDPSKFEVVAQAGG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcacgaccgcacctcggacgagagcgaccttctggcggattcgagctgtac
agctggtattacttccggatcagtggactcctgttgatccttttggcagttggacacgtc
gtgatcatgcacgtcgtgaacacggtcgacgagatcgactggcaattcgtggccgaccgg
tggaattcgccgttctggcgcgtgtacgactggctgctactgttcttggcactgacgcat
gggctgaacggcgctcgtctcgccatcgatgattatgtccgtccgcacggttggcgcgtg
ttcgcccattcggtcctctggaccttggcccttctctttctggtcatcggctcgatcgcg
atcgtgactttcgacccatccaagttcgaagtcgtcgcacaggcaggaggctga

DBGET integrated database retrieval system