KEGG   Thermomicrobium roseum: trd_0332Help
Entry
trd_0332          CDS       T00845                                 

Definition
(GenBank) succinate dehydrogenase, membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tro  Thermomicrobium roseum
Pathway
tro00020  Citrate cycle (TCA cycle)
tro00190  Oxidative phosphorylation
tro00650  Butanoate metabolism
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
Module
tro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    trd_0332
   00650 Butanoate metabolism
    trd_0332
  Energy metabolism
   00190 Oxidative phosphorylation
    trd_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACM06311
UniProt: B9KXZ0
Position
complement(335600..336013)
Genome map
AA seq 137 aa AA seqDB search
MTIARPHLGRERPSGGFELYSWYYFRISGLLLILLAVGHVVIMHVVNTVDEIDWQFVADR
WNSPFWRVYDWLLLFLALTHGLNGARLAIDDYVRPHGWRVFAHSVLWTLALLFLVIGSIA
IVTFDPSKFEVVAQAGG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcacgaccgcacctcggacgagagcgaccttctggcggattcgagctgtac
agctggtattacttccggatcagtggactcctgttgatccttttggcagttggacacgtc
gtgatcatgcacgtcgtgaacacggtcgacgagatcgactggcaattcgtggccgaccgg
tggaattcgccgttctggcgcgtgtacgactggctgctactgttcttggcactgacgcat
gggctgaacggcgctcgtctcgccatcgatgattatgtccgtccgcacggttggcgcgtg
ttcgcccattcggtcctctggaccttggcccttctctttctggtcatcggctcgatcgcg
atcgtgactttcgacccatccaagttcgaagtcgtcgcacaggcaggaggctga

DBGET integrated database retrieval system