KEGG   Thermomicrobium roseum: trd_0495Help
Entry
trd_0495          CDS       T00845                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
tro  Thermomicrobium roseum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_0495 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_0495 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    trd_0495 (aceB)
Enzymes [BR:tro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     trd_0495 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(490918..492486)
Genome map
AA seq 522 aa AA seqDB search
MGDVRIVGRMTPEFAQILTEPALDFVASLHREFNLRRKQLLERRAERQQAIDAGHFPDFL
PETAHIRESEWRVAPTPPDLEDRRVEITGPVDRKMMINALNSGARVFMADFEDALSPTWD
NVVQGQINLRDAVRRTISFESPDGRVYRLADKTATLVVRPRGWHLVERHVLVDGEPISAS
LFDFGLYFFHNAHELLARNTGPYFYLPKLESHLEARLWNDVFNFAQDRLGIPRGTIRATV
LIETILAAFEMDEILWELRDHAAGLNAGRWDYIFSVIKKFRRHREFLLPDRAQVTMTVPF
MRAYTELLVRTCHRRGAHAIGGMAAFIPSRRDPQVNEIALAKVREDKEREAKDGFDGTWV
AHPDLVPVALEVFDRVLGEQPHQKHRLREDVQVTARDLLDVRVPGGRITEGGLRNNVSVA
LQYLDSWLRGQGAAAIFNLMEDTATAEISRAQLWQWRFHRAELDDGRPVTAELYVQIRDE
ELTKLGGEVAGRLREAREILDRLVLDDEFTEFLTYLAYEYID
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgtgcggatcgtgggacgcatgactccggagttcgcccagatcctcaccgaa
ccagccctcgacttcgtcgcgagcctccatcgagagttcaaccttcgccgcaagcagctg
ctcgaacgacgagccgaacgccaacaggcgatcgatgccggccattttcctgattttctt
cccgaaactgctcacattcgtgaaagcgagtggcgtgtcgcgccgactccccctgatctc
gaggatcggcgcgtcgagattaccgggcctgtcgatcgcaaaatgatgatcaacgccctc
aactccggtgcgcgcgtcttcatggcggacttcgaggatgcgctctcgccgacttgggat
aatgtggtgcaaggccagatcaatctccgcgatgccgtccggcgaaccatcagcttcgaa
agcccggacggcagggtctatcgtctcgccgacaagaccgcgacactcgtcgtccgacca
cgcggctggcatctcgtcgaacggcatgtcctggtcgatggagaaccgatctcggcgagt
ctcttcgacttcggtctctactttttccacaacgcgcacgagttgctagccaggaacacc
gggccctacttctacttgcccaaactggagagtcacctggaagcgcgcctctggaacgac
gtcttcaacttcgcccaggatcgcctcggcattccgcggggaacgattcgggcgaccgtc
ctcatcgagacgatcctggctgccttcgagatggacgaaattctctgggaactgcgtgat
catgctgctggactcaatgctgggcgatgggattacatctttagtgtcatcaagaagttc
cgccggcaccgggagttcctcctgcccgatcgggcacaggtcacaatgaccgtgccgttc
atgcgtgcgtacaccgaactcttggtgcggacgtgtcaccgccgtggagcacacgccatc
ggcggaatggctgccttcatccccagccggcgcgatccgcaagtcaacgagatcgccttg
gcgaaggttcgcgaggacaaggaacgggaagccaaggacggcttcgacgggacgtgggtc
gcgcaccctgacctcgtccccgtcgcgctcgaagttttcgatcgcgtcctgggcgagcaa
ccccaccagaagcatcgcctccgcgaggacgtgcaggtgacagcacgcgacttgctggac
gtgcgcgtgccaggaggacggatcaccgagggaggactccggaacaacgtcagtgtcgcg
ctgcagtacctggacagctggctgcgtggccaaggcgccgcggccatcttcaacctgatg
gaggatacggcgactgccgagatctcgcgcgcgcagctctggcagtggcgcttccatcgc
gccgaactcgacgatggtcggccagtcacggccgagttgtacgtccagatccgcgacgag
gaactcaccaagctcggcggagaggtagccggtcggcttcgagaggcgcgcgagatcctc
gatcgtctggtgctcgacgacgagttcaccgagtttctcacctacctggcgtacgagtac
atcgactga

DBGET integrated database retrieval system