KEGG   Thermomicrobium roseum: trd_0528Help
Entry
trd_0528          CDS       T00845                                 

Definition
putative agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tro  Thermomicrobium roseum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tro00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526394..527350
Genome map
AA seq 318 aa AA seqDB search
MPKGYAPVSGLESPRFAGIRTFARLPHVRELAGVDVAIVGAPFDTGVTYRVGARFGPAAV
REMSAMLRTYHPSLDVDVYEVLSVVDYGDLPVVPGYIEDSYQRIEQGLLPLLEHDVVPLV
IGGDHSITLAELRAVARRYGRVGFIQFDSHTDTWDEYWGKKYTHGTPFRRAVEEGLIETT
RAIQVGMRGSLYGPEDLDQSRELGFEVWTADDVRRTGLGAVIEAIRRRVGQGPVFVSFDI
DFLDPVYAPGTGTPEVGGFTTREAQELLRGLVGVDIVAADMVEVLPAHDVSGVTALAAAN
LLFEILAVLAFNRRGMTR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagggctatgctccggtgagcgggctcgagagcccgcgttttgctggaatccgc
accttcgcgcgcttgccccatgtgcgagagctcgccggggtggatgtcgcgatcgtcggt
gcgcccttcgataccggcgtgacctatcgtgtcggggcgcggttcggaccagcggccgtg
cgcgagatgtcggcgatgctgcgaacctaccatccatcactcgatgtcgatgtctacgag
gtactgtcggtcgtcgattacggggacttgccggtcgtgcctggttacatcgaggacagc
tatcagcggatcgaacagggactgttaccgctcctcgagcacgatgtcgtcccgctggtt
atcggtggtgaccactcgatcactttagcggagctgcgcgcggtcgcgcgccgttacggc
cgggtcggattcattcagttcgattcgcacaccgatacatgggacgaatattggggaaag
aagtacacgcatgggacccccttccggcgagcggtggaggaaggattgatcgagacgacg
cgagcgattcaggtcgggatgcgtggctcactctatggaccggaggatctcgaccagtcg
cgggagctgggcttcgaggtgtggacagcggacgacgtgcggcgcaccggactcggcgcg
gtgatcgaagcgatccggcgccgagtcggccaggggccggtcttcgtgagcttcgatatc
gacttcctcgatccggtgtatgcgccaggtaccgggacaccggaggtcggggggttcacg
acgcgcgaagcgcaagaactcttgcgtggactggtcggtgtggacatcgtggcagccgat
atggtggaggtcctgcccgcccatgacgtgagcggcgtcactgccttagctgcggccaac
ctgttattcgagattctggccgttctggccttcaaccggcgcgggatgacgcgctga

DBGET integrated database retrieval system