KEGG   Thermomicrobium roseum: trd_0533Help
Entry
trd_0533          CDS       T00845                                 

Gene name
ureA
Definition
urease subunit gamma
Orthology
K01430  
urease subunit gamma [EC:3.5.1.5]
Organism
tro  Thermomicrobium roseum
Pathway
Purine metabolism
Arginine and proline metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    trd_0533 (ureA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    trd_0533 (ureA)
  Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    trd_0533 (ureA)
Enzymes [BR:tro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     trd_0533 (ureA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(531095..531391)
Genome map
AA seq 98 aa AA seqDB search
MTPKELDRLTVFTLAELARRHRARGIKLNYTEAAALLCDEVYEEARAGRSYEEVVAHASS
LLTRDDVLPGVPEMLTVLHIDALFPDGTRLVTLRNPIR
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgaaggagctcgaccggttgaccgtgttcactttggctgaactcgcccgtcgc
caccgcgcacgcgggatcaagctcaattatacggaggctgctgcccttctctgcgacgaa
gtgtacgaagaagcacgcgctggtcgctcctacgaggaggtggtcgcgcatgccagttcc
ctcctcacgcgcgatgacgttctccctggtgttccggaaatgctcaccgttctccacatc
gacgcgctcttccctgacggtacgcgcctcgtgaccctcaggaatcccatccgatga

DBGET integrated database retrieval system