KEGG   Thermomicrobium roseum: trd_0561Help
Entry
trd_0561          CDS       T00845                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tro  Thermomicrobium roseum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_0561 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    trd_0561 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    trd_0561 (sucB)
Enzymes [BR:tro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     trd_0561 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(554704..556023)
Genome map
AA seq 439 aa AA seqDB search
MAIEVRVPQMGESIVEAVIGAWRKREGDPVNPGDVLVELETEKVNVEVTADRAGVLQHIL
KREGETVTVGEVIALIEETAQVTAPVQETPAEAGRAREPAPLPEVTTAAASQPAQPAGGP
AVRATPAVRRLAEEYGIDLAEVPASGEGGRVTREDVLRYVAQRGAAARPADGAAPQPVAA
APPPAAPPAPGVTPPEAPVVLPFSAAGRREERIRMSQRRKTIARRLVEAQHTAAMLTTFN
EIDMSAVVALRNRWRQQFRERYGVSLGFMSFFTKAVVGALKAFPLLNAEIQGDEIVVKYY
YDIGIAVATDEGLVVPVVRDADRKSFAEIEREIEELARKARERRLTLEELSGGTFTITNG
GVFGSLLSTPILNPPQVGILGMHKIEERPVVVNGEIVIRPMMYVALTYDHRIVDGREAVL
FLVRVKELIEDPERLLLEG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaggttcgtgtgccgcagatgggcgagtcgatcgtcgaggcagtcatcggc
gcctggcggaaacgcgaaggtgatccggtcaacccaggcgacgtgctcgtcgagttggaa
accgaaaaagtcaacgtcgaagtgacagcggatcgagctggtgttctccagcacatcctc
aagcgcgagggagaaacggtgaccgtcggcgaggtcatcgcactgatcgaggagaccgcg
caggtgactgctcccgttcaggaaacccctgccgaagcgggcagagcacgagagccagct
cccttgcccgaggtcacgacagccgcagcgtcgcaaccggcgcaacccgccggcggacca
gcggttagggcgacgccagctgtcaggcgactggccgaggaatacggtatcgacctcgct
gaggtacctgcttccggcgaaggtggtcgggtcactcgggaggacgtgctccgttacgtt
gctcagcgtggagcagccgcccgaccggctgacggtgcggctccccagccagtcgcagcg
gccccaccgccagccgcaccaccggcaccaggtgtcacaccaccggaggcaccggttgtc
ttgcccttctctgctgccggacgccgcgaagaacgcattcggatgagccagcgacgcaag
acgatcgcccggcggttggtcgaggcccagcacaccgcagcgatgctgacgaccttcaac
gagatcgacatgagtgccgtggtcgcccttcgcaaccggtggcgccagcagttccgggaa
cgctacggcgtgagcctcggcttcatgtcattcttcaccaaagctgtcgtcggtgcgttg
aaagctttccccttgttgaacgccgagatccagggtgacgagatcgtcgtcaaatattac
tacgacatcggaatcgccgtcgcgaccgatgaaggactcgtcgtgcccgtcgtccgcgac
gcggaccgtaagtcgttcgcggagatcgagcgcgagatcgaagaactcgcccgcaaggca
cgggaacgacgactgacgctcgaggaactcagcggtggaacctttacgatcaccaatggc
ggcgttttcggctctctcctctcgaccccgattctcaatccccctcaggtcggcatcctc
gggatgcacaagatcgaggaacgaccggtcgtggtcaacggcgagatcgtcattcgcccg
atgatgtacgttgccctcacgtatgaccatcggatcgtggacggtcgggaagctgtgctt
ttcctcgtccgcgtgaaagaactcatcgaggacccagaacgcctgctgctcgaaggctga

DBGET integrated database retrieval system