KEGG   Thermomicrobium roseum: trd_0561Help
Entry
trd_0561          CDS       T00845                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tro  Thermomicrobium roseum
Pathway
tro00020  Citrate cycle (TCA cycle)
tro00310  Lysine degradation
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    trd_0561 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    trd_0561 (sucB)
Enzymes [BR:tro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     trd_0561 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 YqfD DUF896
Motif
Other DBs
NCBI-ProteinID: ACM06102
UniProt: B9KYL5
Position
complement(554704..556023)
Genome map
AA seq 439 aa AA seqDB search
MAIEVRVPQMGESIVEAVIGAWRKREGDPVNPGDVLVELETEKVNVEVTADRAGVLQHIL
KREGETVTVGEVIALIEETAQVTAPVQETPAEAGRAREPAPLPEVTTAAASQPAQPAGGP
AVRATPAVRRLAEEYGIDLAEVPASGEGGRVTREDVLRYVAQRGAAARPADGAAPQPVAA
APPPAAPPAPGVTPPEAPVVLPFSAAGRREERIRMSQRRKTIARRLVEAQHTAAMLTTFN
EIDMSAVVALRNRWRQQFRERYGVSLGFMSFFTKAVVGALKAFPLLNAEIQGDEIVVKYY
YDIGIAVATDEGLVVPVVRDADRKSFAEIEREIEELARKARERRLTLEELSGGTFTITNG
GVFGSLLSTPILNPPQVGILGMHKIEERPVVVNGEIVIRPMMYVALTYDHRIVDGREAVL
FLVRVKELIEDPERLLLEG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaggttcgtgtgccgcagatgggcgagtcgatcgtcgaggcagtcatcggc
gcctggcggaaacgcgaaggtgatccggtcaacccaggcgacgtgctcgtcgagttggaa
accgaaaaagtcaacgtcgaagtgacagcggatcgagctggtgttctccagcacatcctc
aagcgcgagggagaaacggtgaccgtcggcgaggtcatcgcactgatcgaggagaccgcg
caggtgactgctcccgttcaggaaacccctgccgaagcgggcagagcacgagagccagct
cccttgcccgaggtcacgacagccgcagcgtcgcaaccggcgcaacccgccggcggacca
gcggttagggcgacgccagctgtcaggcgactggccgaggaatacggtatcgacctcgct
gaggtacctgcttccggcgaaggtggtcgggtcactcgggaggacgtgctccgttacgtt
gctcagcgtggagcagccgcccgaccggctgacggtgcggctccccagccagtcgcagcg
gccccaccgccagccgcaccaccggcaccaggtgtcacaccaccggaggcaccggttgtc
ttgcccttctctgctgccggacgccgcgaagaacgcattcggatgagccagcgacgcaag
acgatcgcccggcggttggtcgaggcccagcacaccgcagcgatgctgacgaccttcaac
gagatcgacatgagtgccgtggtcgcccttcgcaaccggtggcgccagcagttccgggaa
cgctacggcgtgagcctcggcttcatgtcattcttcaccaaagctgtcgtcggtgcgttg
aaagctttccccttgttgaacgccgagatccagggtgacgagatcgtcgtcaaatattac
tacgacatcggaatcgccgtcgcgaccgatgaaggactcgtcgtgcccgtcgtccgcgac
gcggaccgtaagtcgttcgcggagatcgagcgcgagatcgaagaactcgcccgcaaggca
cgggaacgacgactgacgctcgaggaactcagcggtggaacctttacgatcaccaatggc
ggcgttttcggctctctcctctcgaccccgattctcaatccccctcaggtcggcatcctc
gggatgcacaagatcgaggaacgaccggtcgtggtcaacggcgagatcgtcattcgcccg
atgatgtacgttgccctcacgtatgaccatcggatcgtggacggtcgggaagctgtgctt
ttcctcgtccgcgtgaaagaactcatcgaggacccagaacgcctgctgctcgaaggctga

DBGET integrated database retrieval system