KEGG   Thermomicrobium roseum: trd_0608Help
Entry
trd_0608          CDS       T00845                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tro  Thermomicrobium roseum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_0608
   01230 Biosynthesis of amino acids
    trd_0608
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_0608
   00030 Pentose phosphate pathway
    trd_0608
   00051 Fructose and mannose metabolism
    trd_0608
   00052 Galactose metabolism
    trd_0608
  Energy metabolism
   00680 Methane metabolism
    trd_0608
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    trd_0608
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     trd_0608
Protein phosphatases and associated proteins [BR:tro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     trd_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(601154..602281)
Genome map
AA seq 375 aa AA seqDB search
MAERSLRRIGVLTGGGDAPGLNAALRAVVKTAILRYGWTVIGFEDGYEGAILGRARQLGL
DDVRGLLVRGGTILGASNRANPFFFAHPEQGDTEPRDHSRTLLATLERIGIDALIVIGGE
GSLSIAHRLNEMGLRVIGIPKTIDNDVRGTLQTIGFDTAVTTATEAIDRLHTTAESHHRV
MLVELMGRDAGWIALSAGVAGGADVILIPEIPFVLDRVVEVIRGRRQRRRSFTIVAVAEG
ARPLDGEAVFERTGPLPYQRKYGGISLVLQKQLSRILPTEVRAVVLGHLQRGGTPTPTDR
ALATALGSAAVDALADDDDGVMVAIRAHPAGQATWGIVRVPLAEVARGPRLVPLDHPLVR
AARGIGISFAQQDEE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagagagatcgctccgccggatcggcgttctcaccggcgggggcgatgccccggga
ctcaatgccgccttgcgggccgtcgttaagacagccatcttgcgctacggttggacagtg
atcggctttgaggacgggtacgagggcgcgatcctcggccgcgctcggcaactcgggctc
gacgatgtccgcggtttgctcgtacgaggtggaaccatcctcggcgcttccaaccgtgcc
aacccgttcttcttcgcgcatcctgaacaaggcgacaccgagccgcgtgatcatagtcgg
accctgctcgccacgctcgagcgcatcggcatcgacgccttgatcgtcatcggcggcgaa
gggagcctgtccatcgcgcatcgcctcaacgagatgggacttcgtgtcatcggcatcccc
aaaacgatcgacaatgacgtccggggcacgctccagacgatcggcttcgataccgctgtc
accaccgccaccgaggcgatcgatcgcctgcatacgaccgccgaaagtcaccatcgggtc
atgctggtggaactcatgggccgggacgccgggtggatcgcgctgtccgctggagtcgct
ggtggagcagatgtgatcctgatcccggaaatcccgttcgtcctcgaccgcgtcgtcgag
gtgatacgaggacgacggcaacgcaggcgttccttcaccatcgtcgccgtcgcggaaggt
gctcggccactcgatggcgaagcagtcttcgagcgcactggcccgctcccctatcagcga
aagtacggtggcatttcgctcgttctccaaaaacagttgagtcgcatcctcccgaccgaa
gttcgcgcagtcgtcctcggtcatctccagcgcggaggtacgccgacaccgaccgaccgt
gcgttggcgactgcactcggctcggctgcagttgacgcactcgccgacgatgacgatggc
gtcatggtcgccatccgcgcgcaccctgccgggcaagcgacctggggcatcgtacgggtt
ccattggccgaggtcgcacgcggcccacggctggtccctctcgatcatcccctcgttcgc
gcagcgcgtggaatcggaatcagtttcgcgcaacaggacgaggagtga

DBGET integrated database retrieval system