KEGG   Thermomicrobium roseum: trd_0704Help
Entry
trd_0704          CDS       T00845                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tro  Thermomicrobium roseum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    trd_0704
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     trd_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695461..696441
Genome map
AA seq 326 aa AA seqDB search
MRSFGGRNRWGWTRAMPGRCVVVGSVNTDVVVSVPRFAVAGETIAARDARIVGGGKGANQ
AVGVARWGVPVALVAALGDDPFSEARRAELVADRVDVGAVRRVPGLGGLALIEIDVHGEN
RIVIAPGSNGALDAGWVREQFEVLRIGRGDVVCVQLEIPLEAVGAALQCGRGAGAWCLLN
ATPWTKEAEHLLANCDVLVVNRLEAYQVAGLASSDPLDRVAETLASRVSTVFVTLGVQGA
ICVAQGTRWRCAAPSVAVVDTTAAGDAFVAAVAAGLIEGLEWPSILQRAVWAGSLAVQRF
GAQPSLPEKWEIERALAERPLLVERW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatcgttcggtggcagaaaccgctggggatggacgagagcgatgcctggacgatgc
gtggtcgttgggagcgtcaatactgacgtagtggtgagcgttccgcggttcgctgtggct
ggtgaaaccatcgctgcccgcgacgctcggatcgtcggcggcggaaagggagcgaatcag
gcggtcggagttgcccgctggggagttccggttgcgttggttgctgcactcggcgacgat
ccgttcagcgaagcaaggcgggcggaactggtggccgaccgagtcgatgtcggcgcggtg
cgacgcgtcccggggttgggtggtctcgcgctcatcgagatcgacgttcacggagaaaac
cggatcgtcatcgctcctgggtccaacggtgcgttggatgctggctgggtgcgcgagcag
ttcgaggttctgcgaatcgggcgtggggatgtcgtctgtgtgcaattggaaatcccgctc
gaggcggtgggcgcagctttgcagtgtgggcgaggagctggcgcctggtgtctcctcaac
gccacaccgtggacgaaggaggctgagcatctgctcgcgaactgtgacgtgctggtggtg
aatcggctcgaggcttatcaagtggctgggctggcaagttcggacccactggatcgtgtc
gctgagaccctcgcttcccgcgtttcaacggtgttcgtcacactcggtgtgcagggggcg
atctgtgtcgcgcaggggacgcgctggcgttgtgccgcgccttccgtagcggtcgtggat
acgactgccgctggtgacgcgttcgtcgctgcagtggctgctggactcatcgaaggactc
gagtggccgtcgatcctccagcgagcggtgtgggcaggctcgctcgctgtccaacggttc
ggggcgcagccctcgctaccggagaagtgggaaatcgagcgtgccctggccgagcgacca
ctgctcgtcgaacgctggtga

DBGET integrated database retrieval system