KEGG   Thermomicrobium roseum: trd_0780Help
Entry
trd_0780          CDS       T00845                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tro  Thermomicrobium roseum
Pathway
tro00010  Glycolysis / Gluconeogenesis
tro00051  Fructose and mannose metabolism
tro00562  Inositol phosphate metabolism
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
tro01230  Biosynthesis of amino acids
Module
tro_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_0780 (tpiA)
   00051 Fructose and mannose metabolism
    trd_0780 (tpiA)
   00562 Inositol phosphate metabolism
    trd_0780 (tpiA)
Enzymes [BR:tro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     trd_0780 (tpiA)
Exosome [BR:tro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   trd_0780 (tpiA)
  Exosomal proteins of bladder cancer cells
   trd_0780 (tpiA)
  Exosomal proteins of melanoma cells
   trd_0780 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM05276
UniProt: B9KZ67
Position
768170..768952
Genome map
AA seq 260 aa AA seqDB search
MRRPLIAGNWKMHTTYEQALELARAIQARCGMAEYAEVVLIPPFPWIVPLSRQLNGSSIS
LGAQTCSAFDEGAYTGEVSAKMVAPFCRYVIVGHSERRRLFGETDAVVAAKLRAVLRNGL
QPILCVGETLEERESGATRDIVERQIAAACSDLESGQVARLVIAYEPVWAIGTGRPATSA
DAELVASWIRAWFRERFGSGISEGLRILYGGSVTAANAADFLAVGDIDGALVGGASLDAR
EFCSIVEAAVERAQRIAEGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaccgctgatcgccggtaactggaagatgcacacgacctacgagcaggcgctg
gagttagctcgtgcgatccaggctcgttgtggaatggcggagtatgccgaggtagtcctc
atcccaccgttcccctggatcgtgccgctgtctcggcaacttaacggaagttcgatttcg
ctgggcgcccagacctgcagtgccttcgacgagggcgcctatacgggcgaagtgtctgcc
aagatggtggccccattttgccgctatgtgatcgtcggtcacagcgaacgccgacgcttg
ttcggtgaaacggatgcagtggtcgctgccaagctccgtgctgtgttgcggaacggcctc
cagccgatcctgtgcgtcggggagacgctcgaagaacgggagtcaggcgcgacgagagac
attgtcgagcgacagatcgcagcggcatgcagcgatctcgagagcgggcaggtcgcgcga
ctggtcatcgcgtacgagccggtatgggcaatcgggacgggtcgcccagctacctccgcg
gatgccgagctcgtcgcttcttggatccgtgcctggttccgggaacgattcgggtcgggg
atcagcgaagggctccgtatcctctacggtgggagcgtcacggctgccaacgcagctgac
tttctggcggtcggcgatatcgatggggcgctcgtcggtggggcgagtttggatgcccgc
gagttctgtagcattgtggaggctgctgtggaacgtgcccagcgtatcgccgaaggaggc
tag

DBGET integrated database retrieval system