KEGG   Thermomicrobium roseum: trd_0780Help
Entry
trd_0780          CDS       T00845                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tro  Thermomicrobium roseum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_0780 (tpiA)
   01230 Biosynthesis of amino acids
    trd_0780 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_0780 (tpiA)
   00051 Fructose and mannose metabolism
    trd_0780 (tpiA)
   00562 Inositol phosphate metabolism
    trd_0780 (tpiA)
Enzymes [BR:tro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     trd_0780 (tpiA)
Exosome [BR:tro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   trd_0780 (tpiA)
  Exosomal proteins of bladder cancer cells
   trd_0780 (tpiA)
  Exosomal proteins of melanoma cells
   trd_0780 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
768170..768952
Genome map
AA seq 260 aa AA seqDB search
MRRPLIAGNWKMHTTYEQALELARAIQARCGMAEYAEVVLIPPFPWIVPLSRQLNGSSIS
LGAQTCSAFDEGAYTGEVSAKMVAPFCRYVIVGHSERRRLFGETDAVVAAKLRAVLRNGL
QPILCVGETLEERESGATRDIVERQIAAACSDLESGQVARLVIAYEPVWAIGTGRPATSA
DAELVASWIRAWFRERFGSGISEGLRILYGGSVTAANAADFLAVGDIDGALVGGASLDAR
EFCSIVEAAVERAQRIAEGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaccgctgatcgccggtaactggaagatgcacacgacctacgagcaggcgctg
gagttagctcgtgcgatccaggctcgttgtggaatggcggagtatgccgaggtagtcctc
atcccaccgttcccctggatcgtgccgctgtctcggcaacttaacggaagttcgatttcg
ctgggcgcccagacctgcagtgccttcgacgagggcgcctatacgggcgaagtgtctgcc
aagatggtggccccattttgccgctatgtgatcgtcggtcacagcgaacgccgacgcttg
ttcggtgaaacggatgcagtggtcgctgccaagctccgtgctgtgttgcggaacggcctc
cagccgatcctgtgcgtcggggagacgctcgaagaacgggagtcaggcgcgacgagagac
attgtcgagcgacagatcgcagcggcatgcagcgatctcgagagcgggcaggtcgcgcga
ctggtcatcgcgtacgagccggtatgggcaatcgggacgggtcgcccagctacctccgcg
gatgccgagctcgtcgcttcttggatccgtgcctggttccgggaacgattcgggtcgggg
atcagcgaagggctccgtatcctctacggtgggagcgtcacggctgccaacgcagctgac
tttctggcggtcggcgatatcgatggggcgctcgtcggtggggcgagtttggatgcccgc
gagttctgtagcattgtggaggctgctgtggaacgtgcccagcgtatcgccgaaggaggc
tag

DBGET integrated database retrieval system