KEGG   Thermomicrobium roseum: trd_0924Help
Entry
trd_0924          CDS       T00845                                 

Definition
(GenBank) putative ROK-family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tro  Thermomicrobium roseum
Pathway
tro00010  Glycolysis / Gluconeogenesis
tro00052  Galactose metabolism
tro00500  Starch and sucrose metabolism
tro00520  Amino sugar and nucleotide sugar metabolism
tro00521  Streptomycin biosynthesis
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_0924
   00052 Galactose metabolism
    trd_0924
   00500 Starch and sucrose metabolism
    trd_0924
   00520 Amino sugar and nucleotide sugar metabolism
    trd_0924
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    trd_0924
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    trd_0924
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     trd_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACM05919
UniProt: B9KZT0
Position
906279..907214
Genome map
AA seq 311 aa AA seqDB search
MYGFAIAGGIIRAVVADGKGQILGEASEPLNNLDAPHVLHRLLELARVALGRAGLPPAEL
KAAGVAFGGPVDPERGVTILSPRSPGFEQFPLVALLEEQLRVPTVLENDARAAAFGEAVF
GAARGCQTVIYLHLGSGVGGGIIVDGRLVYGATSTAGEIGHMVVTAGGPLCSCGKPGHLE
AYVAEPALVARVWEALVISPDDPAHRLLSGPISARVLFERAPESPTIQRVLDDTIQMLGL
AIASLIATLNPEAVIIGGPVAEAGSRLLEPLQARVRQYAYPASLRRVRLALAELGPDAPM
IGAVALALART
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgtacggcttcgccatcgctggtggaatcattcgagccgtcgtcgctgacggaaaggga
cagattctcggtgaagcatcggaacccctcaataatctggacgcgccccatgtgctccat
cggcttctcgaactggctcgagttgcactgggtcgcgctggccttccgccagcggaattg
aaggccgccggtgtcgcgttcggcggaccagtggatcccgagcggggcgtcaccatcctc
tcgccacgttcgcccgggttcgagcagtttccgctcgtcgccttgctggaggagcagctg
cgcgtgccgaccgtgctcgagaacgatgcccgagccgccgcgttcggcgaggcggtcttc
ggtgcagctcgcggctgtcaaacagtcatctatctccacctcggctcgggagtcggcgga
ggcatcatcgtggatggacggctcgtctacggtgccacaagtacggctggagagatcggc
cacatggtcgtcacagccggtggaccactctgttcctgcggcaagccgggacatctggaa
gcgtatgttgccgagccagctctcgtcgctcgcgtctgggaagcgctcgttatctcaccg
gatgacccagcgcatcggctcctcagtggaccgatctcggctcgcgtcctgttcgagcgt
gcaccggagagtccgaccattcagcgcgttctcgacgatacgatccagatgctcgggcta
gccatcgcctcgctcatcgccacgctgaatccagaagccgtcatcatcggcggaccggta
gcagaagccggtagtcgtctcctggaacctttgcaggcgcgtgtccgtcaatatgcgtat
cccgcctccctacgccgcgtacgccttgcactcgccgaactcggtccggatgccccgatg
atcggagctgtcgcgctcgccttggctcgcacgtga

DBGET integrated database retrieval system