KEGG   Thermomicrobium roseum: trd_0930Help
Entry
trd_0930          CDS       T00845                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tro  Thermomicrobium roseum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    trd_0930
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    trd_0930
Enzymes [BR:tro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     trd_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911488..913005
Genome map
AA seq 505 aa AA seqDB search
MPALHDLLSDLFAELRGDDAIMVTRVVYDSRQATPGSLFVALRGTHTDGHCYLADAASRG
AVAAVVEEWPSQDVPGLRTIARVSDTRVALAAIAARFYGHPASDLGLIGVTGTDGKTTTT
FLIDAILRTAGYRTGLIGTVALRIGDEFVAHDLRQTTPESLDVQAFLARMRATGVAWAVV
EATSHGLELHRLDHCPFDIAVVTNVTQEHLDFHGTIENYRRAKGRLLEFVRDRPERAYPR
GIVLNADDEGARSLARFAGSVPILWYSATGKAVLVAENARMTDKGTSFRLRYGDQAADVH
LRLFGLWNVENALAAAGTGILLGIPLDQVVTGLQQLAAVPGRFTPIDCGQPFRVIVDYAH
TPKSFERVLPLARSLARGRVIVVFGSAGERDRIKRRLQGAIAARLAEFAVFTSEDPRHED
PDAIIAEIAEGAREAGAQEGQQFVCVEDRALAIREAFRRARPGDIVLLLGKGHEQCILYG
DERRPWNEEAEARQALRELGYDCSS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccggctttgcacgatttgctcagcgatctttttgccgagctgcgtggtgatgacgcg
atcatggtgacccgcgttgtctacgactcccgccaggcaacgccgggcagtcttttcgtc
gcactccgaggtacgcatacggacggacactgttatctcgctgacgctgcctcacgcggt
gcggtggcagcagtcgtcgaagagtggccctctcaagatgtccctggcctacgtaccatc
gctcgagtcagtgacactcgcgtggcgctcgctgccatcgccgcgcgcttctacggtcat
ccagcttccgatctcggcctcatcggagtaaccggtacagacggcaaaacgacgacgacc
ttcctgatcgatgccatactccgcacagccggctaccgaaccggtctcatcggcaccgtc
gcccttcgcatcggtgacgagttcgtggcccacgatctcagacagacgacaccggagtct
ctcgatgtccaggcattcctggctcgcatgcgagcgacgggtgtcgcctgggctgtcgtg
gaggcgacgagtcacgggctggagcttcaccggttggatcattgtcccttcgatatcgca
gtcgtgaccaatgtaacccaggagcatctggatttccacggtaccatcgaaaactaccgg
cgagccaagggaaggctcctggagttcgtccgcgatcgaccggaacgagcttatccgcgt
ggaatcgttctcaatgctgacgacgagggagcacggtcgctcgcgcggttcgctggctcg
gtaccgatcctgtggtactcagcgactggtaaggctgtcctcgtggcggaaaacgcccgc
atgactgacaaaggcacgagtttccgcctccggtatggcgatcaggcggctgatgtgcat
ctgcgactcttcggtctctggaatgtcgaaaatgcgctcgctgctgcaggaaccggcatt
cttctcggaatacccttggaccaggtcgtcaccggtctccagcaactcgcggcggtaccc
gggcgttttaccccgatcgactgcggacagccgttccgtgtgatcgtcgactacgcccac
acaccgaagtcattcgagcgagttctcccgctggcgcgctcccttgcacgcggacgggtg
atcgtcgttttcgggagcgccggtgagcgtgaccgcatcaaacgccggctgcagggagcg
atcgctgctcgccttgccgagttcgccgtcttcacgtcggaggatcctcgtcacgaggac
ccggacgccatcatcgccgaaatcgcagagggagcacgtgaggctggagcgcaagaggga
cagcagttcgtctgtgtagaggatcgggcccttgcgatccgagaagcgttccggcgggca
cgtcccggtgatatcgtcttattgctcgggaagggacacgagcagtgcatactgtacggc
gacgaacgacggccgtggaacgaggaagcagaagccaggcaggcgctccgagaactgggg
tacgactgctcatcctga

DBGET integrated database retrieval system