KEGG   Thermomicrobium roseum: trd_1071Help
Entry
trd_1071          CDS       T00845                                 

Definition
putative peptidic bond hydrolase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tro  Thermomicrobium roseum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_1071
  Amino acid metabolism
   00300 Lysine biosynthesis
    trd_1071
Enzymes [BR:tro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     trd_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045636..1046850
Genome map
AA seq 404 aa AA seqDB search
MNEAPFDPKVAEIVLRSIDQDELTDLASRLVRIPTVNPPGDVREAAELCARFLDRAGFAI
EFDAAEPMKPNLIARYGSGAPPVLLWNSHLDVVPVGEETAWTVPPFAGLVRDGKLYGRGS
CDIKGGVAAQLAAATAIARSGIDLRGTLIVTEVADEEVGGQLGAKRIAERDDLRPDYVLV
AEPTANRICIGERGGVGIRVTVFGRTAHGALPWEGANAIEGMARVITAFQHELWPRLAAR
RHPYFAPASATISLIQGGVKTNVVPDRCSIYIDRRLIPGEQPEEAVAEVREVAQRALEEV
PGLRVVVEAAPEWPGRPAILQPEDSPLVRTMTAVNAYLGLDTTLTGFSMGTDGRFFAARG
CPTLIYGPGDPRLAHQPDEWVSLDELVDCARAYALAAVALLTKP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcgcctttcgacccaaaggtcgccgagatcgtattgaggagtatcgaccag
gacgagctcaccgatctggccagccgactcgtgcgtattcccaccgtgaacccgcctggc
gacgtgcgggaagcagccgaactgtgcgctcgcttcctcgatcgagccggcttcgcgatc
gagttcgacgcagccgagcccatgaagccgaacctgatcgcccgctacgggtccggagcc
ccgccggtcctgttgtggaattctcacctcgacgttgttccggtcggcgaggagaccgcg
tggaccgtaccgccgtttgccggactggtccgggatggcaagttgtatgggcggggaagc
tgtgatatcaagggcggtgtcgctgctcaactcgccgcggcgactgccatcgcccgctcg
ggaatcgatctccgcggcacactcatcgtcaccgaggtcgccgacgaggaagtcggcggc
cagctcggcgccaaacgcatcgccgagcgcgatgatctccgacctgattacgtgctcgtc
gccgaaccgacagccaatcgtatttgcatcggtgagcgcgggggcgttggtatccgcgtg
acggtattcggtcgcacggcgcatggcgcgctgccttgggagggagccaatgccatcgaa
ggcatggcgcgtgttatcacagccttccagcacgaattgtggccacgcctggctgcacgc
agacacccatacttcgcccccgcatcggccacgatcagcttgatccaaggtggagtgaag
acgaacgtggtgccggatcgctgctcgatctacatcgatcgccgcttgattcccggagag
cagcctgaggaagcggtcgctgaggtgcgcgaggtcgcccagcgcgcactcgaggaagtt
cccggactgcgtgtcgtcgtcgaagcagcccccgagtggcctggccgcccagcgatcctc
cagccagaagactcgcccctcgtccgcacgatgaccgcggtcaatgcctatctcgggctc
gatacgaccctgaccggtttcagcatggggacagatggccgcttcttcgctgcccgaggc
tgccccacgctcatctacgggccaggcgatccgcgtctcgcgcaccagccagacgagtgg
gtcagtctggacgaactcgtcgattgcgcacgcgcctacgcactcgctgcagtggctctt
ctgaccaagccgtga

DBGET integrated database retrieval system