KEGG   Thermomicrobium roseum: trd_1096Help
Entry
trd_1096          CDS       T00845                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tro  Thermomicrobium roseum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_1096
   01230 Biosynthesis of amino acids
    trd_1096
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_1096
   00030 Pentose phosphate pathway
    trd_1096
   00051 Fructose and mannose metabolism
    trd_1096
   00052 Galactose metabolism
    trd_1096
  Energy metabolism
   00680 Methane metabolism
    trd_1096
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    trd_1096
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     trd_1096
Protein phosphatases and associated proteins [BR:tro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     trd_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072452..1073642
Genome map
AA seq 396 aa AA seqDB search
MPGETLLVFQSGGPTGVINATLAGVVEQARSSGYTRVLGAQHGITGLVTETLVDLSALSP
AQLDRLARTPGAALGTSRQRLDESSSRAALATLRVHRVTAVVAIGGNDTAASALALLAHA
EQAGYPLAVVLAPKTIDNDLAETDHTPGYPSAARFLALATRDLMLDCRSLATFYAFTVLE
VQGRNAGWLVAACGLAIDESLATHLQLVFPERPPRSSHDLAEEFASLQQRLGWLLLVVPE
TLRREDGRPLAEAAPRWVDPHGHPYPPSPAEALAHALETVCGARARVIRPGALARCFRET
VVELDREEARAIGRTAVEWLATGQSAVMVGIERLSDDPYRVRFRPVPLQRVADHERLLPP
EFISQDGRRATTAFARYARPLVGEFAATETHHAWSR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgagacgctcctcgtctttcagagcggaggtcccaccggagtcatcaacgcg
acactcgccggtgtcgtcgagcaagcccgctcgagcggctacacccgagtgctcggcgcg
cagcacggcatcaccggcctggtcactgagacgctggtcgacctctccgccctttcacct
gctcaactcgaccgactagctcgcactccgggtgcggcactcggtacctcgcgccaacgc
ctagacgagagtagcagtcgagcagcacttgccaccttacgcgtgcaccgcgtgacagcg
gtcgtcgccatcgggggcaacgatacggccgcgagcgcactcgcgctcctggcacatgcc
gaacaggcaggttacccgttggcggtcgtgctcgcccccaagacgatcgacaacgatctt
gcggagacggatcacactcctggctatccttcggctgctcgcttcctcgcactcgcgacg
cgcgatctcatgctcgattgccgctccctcgcgaccttctatgcatttaccgtcctcgag
gtgcaaggacggaatgccggctggctcgtcgccgcttgcgggctcgcgatcgacgagtca
ctggccacgcacctccagctcgtcttccccgagcgccccccgcgatcgagccacgatctc
gctgaggagttcgcctcgctccagcaacggctcggctggctcctcctcgtcgtccccgaa
acgttgcgtcgtgaggacggccgacccttggccgaggcagcgcctcgctgggtcgatcca
cacgggcatccctacccgccgagtccagctgaagcgctcgcgcacgcgctggaaaccgtc
tgtggcgcacgagcacgcgtcatccgaccgggagcgctggcacgctgcttccgggagacg
gtcgtcgaactcgatcgggaagaagctcgcgcgatcggacgaaccgcagtcgaatggctg
gccactggccagtcggcagtcatggtcggcatcgaacgtctcagcgacgatccgtaccgc
gtacggttccggccggttccgctccagcgggtcgccgaccacgagcgcctcctcccgccc
gagttcatcagccaggacggtcgccgggcgacgacagcgttcgcccgctacgcgcgacca
ctggttggggaattcgctgcgacggagacgcaccacgcgtggtcgcgctga

DBGET integrated database retrieval system