KEGG   Thermomicrobium roseum: trd_1127Help
Entry
trd_1127          CDS       T00845                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tro  Thermomicrobium roseum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tro00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112634..1113257)
Genome map
AA seq 207 aa AA seqDB search
MHHHEELVHLEDTGLEFTTTCDLERLRSLVAQWLEIIGEDPHREGLVRTPQRVAEAWAFL
TRGYRQNLHEIVNGAIFHVEQDTMVVVKGIEFYSMCEHHLLPFFGHVHIGYLPRGRILGL
SKFARIVDLYARRLQVQERLTNQIAEAIAELLDPQGVAVVADGIHLCMMMRGVEKQHART
TTSAMLGVFRESAAAREEFYRLLSTSS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatcatgaagaactcgtccacctcgaggatacgggcctcgagttcacgacgacc
tgcgatctggagcgtctgcgctcgttggttgcccagtggttggaaatcatcggcgaggat
ccgcaccgggagggattggtgcggacaccgcagcgcgtcgcggaggcatgggcattcctg
acccggggctaccgccagaatctccacgagatcgtcaatggcgcgatctttcatgtggag
caggataccatggtcgtcgtcaaggggatcgagttttactcgatgtgcgagcaccatctc
ctcccgttcttcggtcatgttcacatcgggtatctgccacgcggccgcattctcgggttg
agtaagttcgcccgcatcgtcgatctctatgcgcgtcgcttacaagtccaggaacgtttg
acaaaccaaatcgcggaagcgattgccgagctgctcgatccccaaggtgtcgcggtcgtg
gccgatggcattcatctctgcatgatgatgcgcggtgtcgagaagcagcacgcgcgcacc
acgaccagcgccatgctcggagtcttccgagaatcggcagcggcccgcgaggagttttac
cgtctcctctccacgagttcctga

DBGET integrated database retrieval system