KEGG   Thermomicrobium roseum: trd_1160Help
Entry
trd_1160          CDS       T00845                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tro  Thermomicrobium roseum
Brite
Enzymes [BR:tro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     trd_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148327..1149154
Genome map
AA seq 275 aa AA seqDB search
MSELWHRLSEPFRSPEHQPIELAGRSPAFILIHGFMGTPAEWRPLAEILHRHGFTVSAPL
LPGFGARIHELAFVTLADWEDALLRTASRTGSNAVIVGFSLGGALATLLAARLQPAALVL
FAPFSRLPLPFWYRRLIPLFERFSAGPRPFARVDFDDPAVRQALSGWNPVLDPSDPLVRD
ELRSFRFPWRLLRELAMTADRARQAAQLVENPVSIVQGRNDTTVPPRDTRNFARAFKNLR
FFIEAPGDHQLVRPEHPAFPLLSRLLVTLGEGISG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagctttggcatcgcttgagcgagcctttccgctcgccggaacaccaaccgatc
gagttggctggtcgatcaccggcattcatcttgattcacgggttcatgggcacaccggcc
gagtggcgaccactcgctgagattctccaccggcacggctttactgtgtcggcaccactg
ctacccgggttcggtgctcggatccacgaactggcgttcgtgacactcgctgattgggaa
gatgcgctcctgcgcaccgccagccggaccggttcgaacgcggtcatcgtcggtttctcg
ctcggtggtgcgctggcaacgctgctcgcggcgcgcctgcaaccagctgcgctggttctc
ttcgctccattctctcgattgcccctgccgttctggtaccgtcgactgatcccgcttttc
gagagattcagcgccggcccgcgccctttcgcccgcgtcgatttcgatgacccggccgtt
cggcaagcgctttccggatggaatccagtgctggatccctcggatccactcgtgcgcgac
gagttacggtcgttccgtttcccctggcgcttgctgcgcgaactcgcgatgaccgccgac
cgcgcccgtcaggctgcccaactcgtcgagaacccggtctccatcgttcagggccgtaac
gacacgactgtcccgccacgcgatacccggaacttcgcccgcgcgttcaagaacctgcga
tttttcatcgaagcaccgggtgatcaccagctcgtccggcccgaacacccagcctttccg
ctcctatcgcgactgctcgtcacgctgggggaagggatcagcggatga

DBGET integrated database retrieval system