KEGG   Thermomicrobium roseum: trd_1226Help
Entry
trd_1226          CDS       T00845                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tro  Thermomicrobium roseum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tro00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tro00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212182..1213456)
Genome map
AA seq 424 aa AA seqDB search
MAITTATERIRTIGGRVLRGRVAIGGAKNAALPAMAAALLTEEECVLENVPLLEDVVVMT
ELLRALGAEVDLDTERHRVRIRAADIESFEPPPELVARMRASFLVTGPLLARFGRARSIP
PGGCQLGSRPVDVDLRGFRKFGAQVEVTESGFELRSGRLRGCEIYMDYPSHTGTENLLMA
ACLAQGTTTILNAAAEPEIVNLGQILQDMGARINGLGTSRIVVQGVDRLRGYRASVLPDR
LEAGTLAIAAAITHGEVILDHVREADMAPLTHKLREAGAEVWWSESSMLVRAPGPLYATE
IQALPFPGFPTDLQAAFAVLMTQAQGRSRIFERVFNDRLRYTSELQRMGARIELIDRQQA
IIEGPVKLQGTAVRALDIRSGACLVLAGLVAEGETIVLEAHHLRRGYEDLVGKLAALGAD
IHYA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcacgacagccaccgagcgaatccggacgatcggcggtcgcgtcctgcgagga
cgtgtcgcgatcggcggcgcaaaaaatgcggctctgccggcgatggctgcggcactcctc
accgaagaagaatgcgtcctcgagaacgtgccgctcctcgaagatgtcgtcgtcatgacc
gagttgctacgggcgctcggtgccgaggtcgatctcgacaccgagcgtcaccgcgtccgc
attcgtgctgccgatatcgagtcgttcgagccgccccctgaactcgtcgcgcgcatgaga
gcgtcctttctcgtgaccggtccattgctggctcgattcggaagggcgcgctcgattcct
cccggtggctgccagctcggtagtcgtccagtcgatgtcgatctccgcggattccgcaag
ttcggggcacaggtcgaagtaacggaaagcggcttcgagctgcggagtggacggcttcgc
ggctgcgagatctacatggattatccgagccataccggcacggaaaatcttttgatggca
gcctgtttggcccaggggacgacgacgatcctcaatgccgcggccgagccggaaatcgtc
aatctcggccaaatcctccaggatatgggagcccgcatcaacggactgggaacctcgcgg
atcgtcgtccagggagtcgatcgcttgcgcggatatcgtgcctctgtattgcctgatcgc
ctcgaggcggggacgctggcgatcgctgccgcgatcacccacggcgaggtgatcctggat
catgtacgggaagctgacatggcaccgctgacgcacaagttgcgggaagcgggagcagaa
gtctggtggagcgaatcctcgatgctggtgcgcgctcctggaccgctctacgcgacggaa
attcaggcgttgcccttcccagggttcccgaccgatctccaggcggcgtttgccgtcctc
atgacgcaagctcaggggcggagtcgtattttcgagcgcgtgttcaacgatcgtctccgc
tacacgagtgagttgcagcggatgggagcacggatcgaactgatcgatcgccagcaggcg
atcatcgaaggacctgtcaagctgcagggtacagcagtgcgtgcgctcgatattcggagc
ggagcctgtctggtcttggcgggtctcgtcgccgaaggagaaacgatcgtcctcgaagcc
caccacttgcgacgtggctacgaggacttggtgggcaagctggccgcgctgggcgcagac
atccactacgcgtga

DBGET integrated database retrieval system