KEGG   Thermomicrobium roseum: trd_1252Help
Entry
trd_1252          CDS       T00845                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tro  Thermomicrobium roseum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_1252 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_1252 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    trd_1252 (thrC)
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     trd_1252 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235913..1237187)
Genome map
AA seq 424 aa AA seqDB search
MGALAQMTLVCDRCSARFEPAGSPGRCQCGGLLHVEFPLAEVVERTNFDVRLSSWQALDR
SGVWRYRELLPPLPAAAIVTRPEGNTALYQHPQLTDWTGCEELFLKHEGENPTGSFKDRG
MTVAISHARTIGAQAVACASTGNTAASVAAYAALAGLPSVVFLPAGKIAAGKLGQAIAYG
ARIVQVEGDFDAAMRLVEEASRELGLYLLNSVNPFRLEGQKTIVFELLHQLGWSVPDWIV
LPGGNLGNTAAFGAALAQLRDVGWLERLPRLAVIQAAGAAPFYAAYRSGFREFRPVTAET
IATAIRIGNPVSYERARRAIELTDGLVDTVSDEEILEAKARVDRTGIGCEPASAASVAGV
RKLVARGVIRPGDRVVAILTGHVLKDPDAVLAYHLGDPPRPLANRPVTIAPTLDALAGVL
ARAL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcgctcgctcagatgactctcgtttgtgaccgttgtagtgcgaggttcgagcct
gcgggatcacctgggcgctgccagtgcggtgggctcctccatgtcgaattcccactcgcg
gaggtggtcgagcgaaccaacttcgatgtccgcttgtcgagttggcaggcgctcgatcgg
agcggcgtctggcgctaccgggagttgctgccgcctctgccagccgccgccatcgtgacg
cgtcccgaaggcaatactgccctgtaccagcatccccaactcaccgactggacggggtgc
gaagagctcttcctcaagcacgagggggaaaatccgaccggctcgttcaaagaccggggg
atgacggtcgcgatttcccatgcgcgaacgatcggtgcgcaggcggtggcctgtgcctcg
acgggaaacacggccgcctcagttgcggcctatgcagccctggcaggtcttcccagtgtg
gtgttcctccccgcgggaaagatcgcggcagggaagctgggccaggcgatcgcgtatgga
gcacggatcgtccaggtggagggcgacttcgatgccgccatgcgcctggtcgaggaggcg
agccgggaactcgggctctacctgctcaattcggtgaacccgtttcgcctggaggggcaa
aagacgatcgtgttcgagctgctgcatcagctcgggtggagcgtcccggactggatcgtg
ctgcccggcgggaatctcggcaacaccgcggcctttggggcagcactggctcagttgcgt
gacgtgggatggctcgagcgcctgccgcgcctggcagtgatccaggccgcgggggctgcg
ccgttttacgcagcctaccggagtggcttccgggagtttcgtcccgttaccgctgagacc
atcgcgacggcgatccggatcggaaatccggtgagttacgagcgtgctcgccgtgcgatc
gagctgaccgacggtctcgtggacacggtcagcgacgaggagatcctggaggcgaaggca
cgcgtcgatcgaacgggaatcgggtgcgaaccggcatcagctgcctcggtcgccggcgtt
cgcaagctcgtcgcgcgaggggtcattcggccaggcgatcgagttgtggcgattctcact
ggtcatgtcttgaaggatccggatgcagtcttggcgtatcatctcggggatcctccacga
ccgcttgcgaaccggccggtgacgatcgcgcccaccctcgacgcactggcaggagtattg
gctcgtgcgttgtga

DBGET integrated database retrieval system