KEGG   Thermomicrobium roseum: trd_1307Help
Entry
trd_1307          CDS       T00845                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tro  Thermomicrobium roseum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    trd_1307 (ispE)
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     trd_1307 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1297746..1298630
Genome map
AA seq 294 aa AA seqDB search
MTIRVGVRKPFRLLAPAKLNLGLEILGKRPDSYHEIVTILQTIDFGDEIVLEPATALDYR
PPTEFEDDLTARALRLLAGHGVEIRARIRLSKRIPIAAGLGGGSSDAGTLLGALVHAGLP
YSLARRIASDLGSDVPFFLEGGTALATDRGTELEPLSSPTGWFVIVVPPLSLRNKTRTLY
SSLTPADYSDGTATRRQAEHLRQYHVLDPHLIRNAFLRPLLAFPQVRLALDDMRAAGAQW
AWPSGAGPALFTWSPQQSQAEEIAVLLRARGWEPIVAAPYRPTWHEALASLALD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcgcgtcggagtccggaagcctttccgcttgctggcacctgcgaaactcaac
ctcggtttggagatcctgggcaaacgaccagacagctaccacgagatcgtgaccatcttg
cagacgatcgacttcggtgacgagatcgtgctcgagccggcaacggccctcgactatcgg
ccaccgactgaattcgaggacgacctgaccgcgcgcgcattgcggctgctcgccgggcat
ggtgtcgagatccgagcgcgcattcggctctccaagcggataccgatcgctgccgggctc
ggcgggggatcgagcgatgcgggcacgctactcggtgcgctggtccatgctggactcccg
tactcgctggcacgcaggatcgcgagcgacctggggagcgatgtgccgttcttcctcgag
ggaggcacagcactcgccaccgatcggggcaccgagttggaaccactttcctcgccgact
ggttggtttgtgatcgtcgtcccgcctctctccttgaggaacaaaacgcgcacgctctac
agttccctcactccggccgattacagcgacggtactgcgacgcgtcgtcaagccgaacat
ctccgccagtaccacgtgttggatcctcatctcatccgcaacgcgttccttcgtcctttg
ctagcgtttccccaagttcggctcgcgctggacgacatgcgagctgctggagcgcagtgg
gcatggcccagtggtgccggtcccgccctcttcacgtggagcccgcaacagtcccaagcc
gaagagatcgccgtgctcctgcgggcacgcggttgggagccgatcgttgccgcaccgtac
cgaccgacctggcatgaagcgctcgcttcgctcgcactggactga

DBGET integrated database retrieval system