KEGG   Thermomicrobium roseum: trd_1393Help
Entry
trd_1393          CDS       T00845                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tro  Thermomicrobium roseum
Pathway
tro00360  Phenylalanine metabolism
tro00362  Benzoate degradation
tro00620  Pyruvate metabolism
tro00621  Dioxin degradation
tro00622  Xylene degradation
tro00650  Butanoate metabolism
tro01100  Metabolic pathways
tro01120  Microbial metabolism in diverse environments
tro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_1393
   00650 Butanoate metabolism
    trd_1393
  Amino acid metabolism
   00360 Phenylalanine metabolism
    trd_1393
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    trd_1393
   00622 Xylene degradation
    trd_1393
   00621 Dioxin degradation
    trd_1393
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     trd_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACM04754
UniProt: B9L2J1
Position
complement(1382460..1383554)
Genome map
AA seq 364 aa AA seqDB search
MCGRADPRRERSRHRGDESLGAGLPLLSEPTAAHHRDRRCCATGFGRTRVLSGGLGMGER
QAVKVAILGTGNIGTDLMYKLLRNPGHMELAMFAGIDPQSEGIARAKKLGIPTSYEGIKA
VLDDPEIRIVFDATSAKAHVRHAKMLREAGKIAIDLTPAARGPYVVPPVNLGAHLDKDNV
NLITCGGQATIPLVFAVSRVVPVRYAEIVSTVASKSAGPGTRQNIDEFTFTTAHGLEAIG
GAEQGKAIIILNPAEPPIIMRNTVYVIPANEEFDQAAIVASVDQMVAEVQQYVPGYRLKD
APVFDRRRTPWGERTIIAMLLEVEGAGDFLPPYSGNLDIMTAAAWRVGELFAQHLLGIRQ
EVAA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcggccgcgccgatccgcgacgagagcggtcacgtcatcgcggcgatgagtctctc
ggtgccggcctaccgcttctatccgaaccgacagcggctcaccaccgcgatcgtcgatgc
tgcgcgacgggtttcggaagaactcgggtactatcaggaggattgggcatgggagaacgg
caagcggtcaaggtcgcgatcctcggtaccgggaatatcggtaccgacctgatgtacaag
ctcttgcggaatccgggccacatggaattggccatgttcgccgggatcgatccgcagtcg
gaggggatcgcccgcgccaagaaactaggtatcccgacgagctacgaggggatcaaggcg
gtcctggatgaccccgagatccggatcgtgttcgatgccaccagcgccaaagcgcacgtt
cgtcacgccaagatgctgcgcgaggctggcaagatcgcgatcgatctgacgccagctgcc
cgcggtccgtacgtcgtgccgccggtcaacctcggcgcacacctggacaaggacaacgtc
aacctgatcacttgcggcgggcaggcgaccatcccgctcgtctttgctgtcagtcgcgtc
gtaccggtgcgctacgccgagatcgtctcgaccgtcgccagcaagtcggcgggaccagga
acgcggcagaacatcgacgagttcacgttcacgaccgcccatgggctcgaggcgatcggg
ggagctgagcaggggaaggcgatcatcattctcaacccggctgagccgccgatcatcatg
cgcaataccgtgtacgtcattcccgcgaacgaggagttcgaccaggcggcgatcgtggcg
tcggtcgaccagatggtcgccgaagtgcagcaatacgtccccgggtatcgcctcaaggac
gcgccggtcttcgaccggcggcgcacaccgtggggcgaacgaacaattatcgccatgttg
ctcgaggtcgagggggccggtgatttcttgccgccctattccggcaatctcgacatcatg
acggcagcggcctggcgggtgggtgagttgttcgcccagcatttgctgggtatccggcag
gaggtggcggcatga

DBGET integrated database retrieval system