KEGG   Thermomicrobium roseum: trd_1393Help
Entry
trd_1393          CDS       T00845                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tro  Thermomicrobium roseum
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    trd_1393
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_1393
   00650 Butanoate metabolism
    trd_1393
  Amino acid metabolism
   00360 Phenylalanine metabolism
    trd_1393
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    trd_1393
   00622 Xylene degradation
    trd_1393
   00621 Dioxin degradation
    trd_1393
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     trd_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1382460..1383554)
Genome map
AA seq 364 aa AA seqDB search
MCGRADPRRERSRHRGDESLGAGLPLLSEPTAAHHRDRRCCATGFGRTRVLSGGLGMGER
QAVKVAILGTGNIGTDLMYKLLRNPGHMELAMFAGIDPQSEGIARAKKLGIPTSYEGIKA
VLDDPEIRIVFDATSAKAHVRHAKMLREAGKIAIDLTPAARGPYVVPPVNLGAHLDKDNV
NLITCGGQATIPLVFAVSRVVPVRYAEIVSTVASKSAGPGTRQNIDEFTFTTAHGLEAIG
GAEQGKAIIILNPAEPPIIMRNTVYVIPANEEFDQAAIVASVDQMVAEVQQYVPGYRLKD
APVFDRRRTPWGERTIIAMLLEVEGAGDFLPPYSGNLDIMTAAAWRVGELFAQHLLGIRQ
EVAA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcggccgcgccgatccgcgacgagagcggtcacgtcatcgcggcgatgagtctctc
ggtgccggcctaccgcttctatccgaaccgacagcggctcaccaccgcgatcgtcgatgc
tgcgcgacgggtttcggaagaactcgggtactatcaggaggattgggcatgggagaacgg
caagcggtcaaggtcgcgatcctcggtaccgggaatatcggtaccgacctgatgtacaag
ctcttgcggaatccgggccacatggaattggccatgttcgccgggatcgatccgcagtcg
gaggggatcgcccgcgccaagaaactaggtatcccgacgagctacgaggggatcaaggcg
gtcctggatgaccccgagatccggatcgtgttcgatgccaccagcgccaaagcgcacgtt
cgtcacgccaagatgctgcgcgaggctggcaagatcgcgatcgatctgacgccagctgcc
cgcggtccgtacgtcgtgccgccggtcaacctcggcgcacacctggacaaggacaacgtc
aacctgatcacttgcggcgggcaggcgaccatcccgctcgtctttgctgtcagtcgcgtc
gtaccggtgcgctacgccgagatcgtctcgaccgtcgccagcaagtcggcgggaccagga
acgcggcagaacatcgacgagttcacgttcacgaccgcccatgggctcgaggcgatcggg
ggagctgagcaggggaaggcgatcatcattctcaacccggctgagccgccgatcatcatg
cgcaataccgtgtacgtcattcccgcgaacgaggagttcgaccaggcggcgatcgtggcg
tcggtcgaccagatggtcgccgaagtgcagcaatacgtccccgggtatcgcctcaaggac
gcgccggtcttcgaccggcggcgcacaccgtggggcgaacgaacaattatcgccatgttg
ctcgaggtcgagggggccggtgatttcttgccgccctattccggcaatctcgacatcatg
acggcagcggcctggcgggtgggtgagttgttcgcccagcatttgctgggtatccggcag
gaggtggcggcatga

DBGET integrated database retrieval system