KEGG   Thermomicrobium roseum: trd_1607Help
Entry
trd_1607          CDS       T00845                                 

Definition
(GenBank) transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tro  Thermomicrobium roseum
Pathway
tro00010  Glycolysis / Gluconeogenesis
tro00052  Galactose metabolism
tro00500  Starch and sucrose metabolism
tro00520  Amino sugar and nucleotide sugar metabolism
tro00521  Streptomycin biosynthesis
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_1607
   00052 Galactose metabolism
    trd_1607
   00500 Starch and sucrose metabolism
    trd_1607
   00520 Amino sugar and nucleotide sugar metabolism
    trd_1607
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    trd_1607
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    trd_1607
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     trd_1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACM05337
UniProt: B9L0B4
Position
1600451..1601428
Genome map
AA seq 325 aa AA seqDB search
MDAVLAVDFGATNLRAALVRRDGTLAFHRQTATGARDGVVAVVERIVRLVDEVAADAGVD
RAIPVGVVAPGPLEPATGVVLFAPNLVGWQRVPLRRMLEERLGRRVVLGNDGNGAALGEA
LFGAAKGCRHLVHLMLGTGVGGGVIAHGQLIEGVRGLGTEVGHVPVDPTGPRCHCGGVGC
VEAYIGGWALARDGEALRNSGRSERLRELAGDGPVTAAHVVEAARAGDAGARAILEQAAR
ALAVGLAGLVNVFDPEMIVIGGGVARAGELLLDPLRRWLPVYAIHYIVEHTELRLSALGD
DTGLYGAAARAFLASEHAGAEIRLP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtcctcgcggtcgacttcggagcgaccaacctgcgtgccgcgctcgtccgg
cgcgatggcacgctggctttccaccgccagacagcgaccggggcgcgcgatggagtcgtc
gcggtcgtcgaacggatcgtgcggctggtcgacgaggtcgcggcggatgccggcgtcgat
cgtgcgataccggtcggcgtcgtggcacccgggccactcgagccagcgaccggtgtcgtg
ctcttcgcccccaacctggtcggctggcaacgtgtcccgctccgccggatgctggaagag
cgactcgggcgccgggtggtcctgggaaacgatggcaacggggcagctctgggcgaggcg
ctcttcggtgccgccaaggggtgccggcacctcgtgcatctgatgctaggcacgggcgtc
gggggcggcgtgatcgcccatggtcagctgatcgaaggagtgcgcgggctcgggacggaa
gtcgggcacgtgccggtcgatccgaccggtccacgctgccattgcggcggggtgggctgc
gtcgaggcctacatcggcggctgggcgctagcccgcgacggcgaggcactgcgcaactcc
gggcgttccgagcgtctgcgggagctggcgggggatggcccggtgaccgctgcccatgtg
gtggaagcggcgcgagccggcgacgcaggtgcacgggcgattctggagcaggcggcccgt
gcactggcagtcgggttggctgggctggtcaacgtgttcgaccctgaaatgatcgtcatc
ggtggcggcgttgctcgcgccggggaactcctgctcgacccgttgcgtcgttggttgccg
gtctacgcgattcactacatcgtggagcataccgagctgcggctctcggccctcggtgac
gataccgggctctacggtgctgctgcccgcgccttcctcgctagcgagcatgcgggagcc
gagatccgtttgccctga

DBGET integrated database retrieval system