KEGG   Thermomicrobium roseum: trd_1612Help
Entry
trd_1612          CDS       T00845                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tro  Thermomicrobium roseum
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tro00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605882..1606904
Genome map
AA seq 340 aa AA seqDB search
MRLAALPRFPLAQLPTPLEEATRLSHALGGVRILVKRDDLTGLALGGNKTRKLEYLIGDA
LAQGASLVLTEGPAQSNHCRQTAAAAARAGLRCVLVLNSPDPAPPLQGNLLLDHLFGAEV
HLVRHRDERHAELEHLANLFAARGDRPYVIPTGGSTPVGAAAYVRAALELAAQLVERGVM
ATRVYLATSTSGGTHAGMVLGASLLGQPFEVIGVAVEDEAEAIRQRVAALAEATAELLGL
ERRFPPEAIIVDDRWVGPGYGVPSEETLEAIVLAARTEGLVLDPVYTGKAMAALIGQIRR
GEIASGETVVFLHTGGAPALFAQAERLAAVVASQRPVVEP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgattggctgcattgccgcgctttcccctggcccagctgccgacgccgctcgaggag
gcgacccggctgagccacgccctgggcggtgtccggatcctggtcaaacgagacgatctc
accgggctggcactgggagggaacaagacgcgcaagctggaatacctcatcggcgatgcc
ctggcccagggagcctcgctggtgctcaccgaggggccagcgcaatcgaaccactgccgc
cagacagccgccgcagcggcacgagctggactgcgctgcgtgctcgtcctgaattcaccc
gatcctgctccaccactgcagggtaatctcctgctcgatcatctcttcggtgccgaggtg
cacctcgtccgtcatcgggacgagcggcacgccgaactcgagcacttggcgaaccttttc
gcggcgcgtggcgaccgcccttatgtcatcccaaccggtggttcgacgccggtcggcgca
gctgcttacgtgcgggcagcactggagctggctgctcagctggtcgaacgcggagtgatg
gcgacgcgcgtgtacctcgcgacgtcgacctcgggtgggacacacgctgggatggtcctc
ggcgcttcgctgctcggccagccgttcgaggtcatcggtgtggccgtcgaggacgaggcc
gaggcgattcggcagcgcgtggcagcgctggccgaagcgaccgctgagctactcggcctg
gaacgacggtttcctccggaagcgatcatcgtcgatgaccgatgggtcgggccgggatac
ggtgtgcccagtgaggagacgctggaagcgatcgtgctggctgcccgaacggaagggctc
gtgctcgatccggtgtacactggcaaggcgatggccgcactgatcggacagatccgccgc
ggggagatcgcttcgggggagacggtcgtcttcctgcataccggcggtgcgcctgctctt
tttgcccaggcggagcgattggccgctgtcgtggcgagccagcgaccagtggtggaaccg
tga

DBGET integrated database retrieval system