KEGG   Thermomicrobium roseum: trd_1615Help
Entry
trd_1615          CDS       T00845                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tro  Thermomicrobium roseum
Pathway
tro00230  Purine metabolism
tro01100  Metabolic pathways
Module
tro_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    trd_1615
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     trd_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_18 AAA_33 AAA_22 AAA_16 TniB Zeta_toxin Rad17 Thymidylate_kin AAA_29
Motif
Other DBs
NCBI-ProteinID: ACM05880
UniProt: B9L0C2
Position
complement(1609918..1610571)
Genome map
AA seq 217 aa AA seqDB search
MTDDLGLNTQADELLEELRQRVRPKLIVISGPSGVGKDTVIERMRQAHPEFHFAVTATTR
PRRPGEIDGVHYIFMTREEFLAARDRGEFLESAEVYGHLYGVPKERVRRALRSGKTVVVK
VDVQGAASIRRLVPQAILIFLAPPSMSELMHRLRSRKTDDPTTLMERIATASRELAQVYE
FDYVVFNETDRLDQTLATIDAILVAEQSRVHQAEIVL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgacctcggattgaatacgcaggccgatgaactcctcgaagaactccggcag
cgtgtccgtcccaagttgatcgtcatctccggaccatccggtgtcggcaaggacaccgtc
atcgagcggatgcgtcaagcgcatcccgagttccatttcgcggtcaccgcgaccacgcgt
ccgcgtcggcctggtgagatcgacggtgtccattacattttcatgacgcgcgaggagttc
ttggccgctcgtgaccgtggcgaatttctcgagtcggcggaggtctacggacatctctac
ggtgtccccaaggagcgggtgcgccgcgccttgcgcagcggcaagacggtggtcgtcaaa
gtcgacgtgcagggagcagcgtcgatccggcggctcgtgccgcaggcgatcctgatcttc
ctcgccccaccctcgatgtccgaactgatgcaccgcttgcgcagccgcaagacggacgat
ccgaccacgctcatggagcggatcgcgaccgcatcccgggaactcgctcaggtttacgag
ttcgactacgtcgtcttcaacgagacggatcggttggaccagacgcttgccacgatcgac
gcgatcctcgttgcggagcagagccgcgtccatcaggccgaaatcgtgctctga

DBGET integrated database retrieval system