KEGG   Thermomicrobium roseum: trd_1700Help
Entry
trd_1700          CDS       T00845                                 

Gene name
xseA
Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
tro  Thermomicrobium roseum
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tro03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702987..1704204
Genome map
AA seq 405 aa AA seqDB search
MLPSEVIGVAALTRFIKDLLEEHPNLRLLRVRGEITNARTYASGHWYFNLREGEAILRCV
LFRSQAQLLTYLPRDGDEAIASGSLGVYERDGVYQLYVEHLQPLGDGALRQQFERLKEKL
EREGLFDQRRKRPLPLRPRCIAVVTSPHGAVWHDIQTILRRRYPYVHLLLAPARVQGDDA
VETLIAALESVQLDGRAEVVIIARGGGSLEDLWCFNDERLARAIYASRIPVVSAIGHETD
WTICDYVADLRAPTPSAAAELVTPHDRRTLVRQLVDLEERLEALATRRLVRTRDHVGQLQ
HRLHRAAPLHRMDNLRQRLDQSAQRIDRAILLRLARQRQHVQALGRELELLSPYGPLARG
YLLAEDSASGEVVRSIRQVSLGQALRLHFSDGQAETIVRSIELSE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgagcgaggtcatcggggtcgccgctctcacccgcttcatcaaggacctcctg
gaagagcacccgaacctccgcctgctccgtgtgcgcggtgagatcaccaacgctcgaacg
tatgccagtggacactggtacttcaatctgcgcgagggagaagcgatcctgcgttgcgtt
ctgttccgcagtcaggcacaactcctgacctatctcccccgcgatggcgacgaagcgatc
gccagtgggtcactgggcgtctatgagcgcgacggtgtctaccagctgtatgtcgagcac
ctccagccgctcggcgatggcgcattgcgccagcagttcgagcgcctcaaggaaaagctg
gaacgcgagggattgttcgatcagcgtcgcaagcgtcccctgccgctgcgtccccgctgc
atcgcggtggtgacctcccctcacggggcagtctggcacgacatccaaaccattctgcgt
cgccgctatccctacgtgcacctgttgctcgccccggcccgcgtgcagggagacgatgcg
gtcgagacactcatcgccgctctggagtcggtccaactggacggacgggcggaggtcgtc
atcatcgcccgtggtggcggatcgctcgaagacctctggtgtttcaacgacgagcgactg
gcccgagcgatctacgcgagcaggattccggtcgtgtcagccatcggtcacgagacagat
tggacgatctgcgactacgtcgccgacctccgtgcaccgacaccgtcagcggctgccgaa
ctggtcacgccacacgatcgtcgtaccctggtcaggcaactcgtcgatttggaagagcgg
ctggaagcgctggccacacgccggctggtgcgtacgcgtgaccatgttgggcagctccag
catcgacttcaccgtgcagcgcccctgcaccgcatggacaacctgcggcaacgcctggat
cagtcagctcagcggatcgaccgagcgatcctgctgcgcttggcacgccaacgccagcac
gtgcaagcactcggccgcgaactggaattgctcagcccctacggcccgttagctcggggt
tacctcctggccgaggacagtgccagtggtgaggtcgtccgttccatccgtcaggtcagt
ctcggccaggctctccgccttcacttcagcgacggtcaggctgagacgatcgtccgatcg
atcgagttgagcgaatga

DBGET integrated database retrieval system