KEGG   Thermomicrobium roseum: trd_1700Help
Entry
trd_1700          CDS       T00845                                 

Gene name
xseA
Definition
exodeoxyribonuclease VII large subunit (EC:3.1.11.6)
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
tro  Thermomicrobium roseum
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:tro00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    trd_1700 (xseA)
Enzymes [BR:tro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     trd_1700 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702987..1704204
Genome map
AA seq 405 aa AA seqDB search
MLPSEVIGVAALTRFIKDLLEEHPNLRLLRVRGEITNARTYASGHWYFNLREGEAILRCV
LFRSQAQLLTYLPRDGDEAIASGSLGVYERDGVYQLYVEHLQPLGDGALRQQFERLKEKL
EREGLFDQRRKRPLPLRPRCIAVVTSPHGAVWHDIQTILRRRYPYVHLLLAPARVQGDDA
VETLIAALESVQLDGRAEVVIIARGGGSLEDLWCFNDERLARAIYASRIPVVSAIGHETD
WTICDYVADLRAPTPSAAAELVTPHDRRTLVRQLVDLEERLEALATRRLVRTRDHVGQLQ
HRLHRAAPLHRMDNLRQRLDQSAQRIDRAILLRLARQRQHVQALGRELELLSPYGPLARG
YLLAEDSASGEVVRSIRQVSLGQALRLHFSDGQAETIVRSIELSE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgagcgaggtcatcggggtcgccgctctcacccgcttcatcaaggacctcctg
gaagagcacccgaacctccgcctgctccgtgtgcgcggtgagatcaccaacgctcgaacg
tatgccagtggacactggtacttcaatctgcgcgagggagaagcgatcctgcgttgcgtt
ctgttccgcagtcaggcacaactcctgacctatctcccccgcgatggcgacgaagcgatc
gccagtgggtcactgggcgtctatgagcgcgacggtgtctaccagctgtatgtcgagcac
ctccagccgctcggcgatggcgcattgcgccagcagttcgagcgcctcaaggaaaagctg
gaacgcgagggattgttcgatcagcgtcgcaagcgtcccctgccgctgcgtccccgctgc
atcgcggtggtgacctcccctcacggggcagtctggcacgacatccaaaccattctgcgt
cgccgctatccctacgtgcacctgttgctcgccccggcccgcgtgcagggagacgatgcg
gtcgagacactcatcgccgctctggagtcggtccaactggacggacgggcggaggtcgtc
atcatcgcccgtggtggcggatcgctcgaagacctctggtgtttcaacgacgagcgactg
gcccgagcgatctacgcgagcaggattccggtcgtgtcagccatcggtcacgagacagat
tggacgatctgcgactacgtcgccgacctccgtgcaccgacaccgtcagcggctgccgaa
ctggtcacgccacacgatcgtcgtaccctggtcaggcaactcgtcgatttggaagagcgg
ctggaagcgctggccacacgccggctggtgcgtacgcgtgaccatgttgggcagctccag
catcgacttcaccgtgcagcgcccctgcaccgcatggacaacctgcggcaacgcctggat
cagtcagctcagcggatcgaccgagcgatcctgctgcgcttggcacgccaacgccagcac
gtgcaagcactcggccgcgaactggaattgctcagcccctacggcccgttagctcggggt
tacctcctggccgaggacagtgccagtggtgaggtcgtccgttccatccgtcaggtcagt
ctcggccaggctctccgccttcacttcagcgacggtcaggctgagacgatcgtccgatcg
atcgagttgagcgaatga

DBGET integrated database retrieval system