KEGG   Thermomicrobium roseum: trd_1735Help
Entry
trd_1735          CDS       T00845                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tro  Thermomicrobium roseum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    trd_1735 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_1735 (aceF)
   00020 Citrate cycle (TCA cycle)
    trd_1735 (aceF)
   00620 Pyruvate metabolism
    trd_1735 (aceF)
Enzymes [BR:tro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     trd_1735 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738021..1739349
Genome map
AA seq 442 aa AA seqDB search
MARPLVMPQMGYDMKEGTILRWLKHEGDRVERGEPIAEIETDKVNLEIESFASGVILKLL
AKEGETVPVGQPIALIGEPGEKVEEEAVPAPAVVGAATAAGTVTAPGPRAPEAAPLEEGP
TAPGERVRASPLVRRLAAEHGIDLSKIRGSGPGGRIVKEDILPLIAAPRAPLAPEQPAPA
AAPPPPPVPPAAPPAAAAPAVAVAPVPGLPEFEVIELSRIRQTIARRMAESFQQAPHFFV
TTVAEVDALLALREQINAQVPEEERVSVTDLLIKACALALRDFPTLNASFVPPNQLRIYK
RIDINIAVATEHGLIAPYVPDADHKPLAEIARLTKDLIARAREERLRPEEYQGGTFTISN
LGMFGLVEHFTAIINPPQAAILAVGSILREPVYREGSEEPVPVRRLRLTLSVDHRVADGA
VAARFLETVRTLLEQPMLLLVR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaccgctcgtcatgccccagatggggtatgacatgaaagaaggcactatcctt
cgctggctcaagcatgagggggaccgcgtcgagcgcggcgaaccgatcgccgaaatcgag
accgacaaggtcaatctggagatcgagtcgttcgcctcgggcgtgatcctgaagcttctg
gccaaggagggagaaaccgttccggtcgggcaaccgatcgccctgatcggtgagcccggt
gagaaggtggaagaagaggctgtaccagctcctgcggttgtcggcgctgccactgcggca
ggaaccgtcaccgccccaggaccgagggcgccggaagccgccccgctcgaggagggcccc
accgcacccggtgaacgggttcgcgcctcaccgctcgtccggcggctcgctgccgagcac
ggcatcgacctcagcaagatccgcgggagcggccctggcggtcgcatcgtcaaagaggac
atcttgccgctcatcgctgcaccacgcgcaccgttggcacccgagcagccagctccggcc
gctgcaccaccgccaccaccggtacccccagccgctccgccagcagcggcggcaccagcg
gtggccgttgcaccggttccaggattgcccgagttcgaagtgatcgagctctctcgcatc
cggcaaacgatcgctcgccggatggccgagagcttccagcaagcgccgcacttcttcgtc
accactgtcgccgaggtcgacgcgctgctcgccctgcgcgagcagatcaacgcgcaggtc
ccagaggaggaacgcgtctcggtgaccgatcttttgatcaaagcctgcgcactggcactg
cgcgacttcccgacgctgaacgcgagcttcgtcccacccaaccagctacgcatctacaag
cgcatcgacatcaacatcgcggtcgcgaccgagcacggcttgatcgcgccctacgtgccg
gacgctgaccacaaacccctcgcggagatcgcgcggctgaccaaggatctgatcgcgcgc
gcccgtgaggaacgcttgcgtcccgaggaatatcaaggggggaccttcacgatttccaac
ctcgggatgttcgggctggtcgaacacttcacggccatcatcaacccaccccaggcagcg
atcctcgcagtgggaagcatcctgcgcgaaccggtctatcgcgagggaagcgaggagccg
gtaccggtgcgccgcctgcgtctgaccctttcggtcgaccatcgcgtcgccgacggcgcc
gttgccgcccgcttcctcgagaccgtacgcacgcttctggagcagccgatgctgctgctc
gtccgctga

DBGET integrated database retrieval system