KEGG   Thermomicrobium roseum: trd_1804Help
Entry
trd_1804          CDS       T00845                                 

Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tro  Thermomicrobium roseum
Pathway
tro00020  Citrate cycle (TCA cycle)
tro00640  Propanoate metabolism
tro00660  C5-Branched dibasic acid metabolism
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    trd_1804
   00640 Propanoate metabolism
    trd_1804
   00660 C5-Branched dibasic acid metabolism
    trd_1804
Enzymes [BR:tro01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     trd_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Peripla_BP_3 CPSase_L_D2 GARS_A Succ_CoA_lig ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACM05433
UniProt: B9L193
Position
complement(1808352..1809524)
Genome map
AA seq 390 aa AA seqDB search
MIGAVVESEGGAMDLHEYQAAELFARYGIPVNRGIVARTPEEASAAAEQLGGRVVVKAQV
HAGGRGKAGGIRLADDPVQAEAVARQILGMEIRGRIVRKVLVAPAVAFEREYYLGAVLDR
DSRRIVVMASSAGGVDIEEVARERPTAIVREQADPFLGFLDFQARRLAFRLGIEPDLVRG
FATIARQLYRAFVDNDASLAEINPLVLTQDRSWLALDTKVVLDDNGLFRHPDLAELRDPE
EEDPLEREARLAGISFVRLNGTVGCIVNGAGLSMATMDAIKLYGGEPANFLDIGGGASAQ
RVAAALRIVVADPNVRAILVNIFGGITRGDVVAQGILEALRQVEVRVPMVIRLVGTRQEE
GRRLLEEAGFTVVDTMEEAAQRAVALAQGQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcgcggtagtcgagtcggaaggcggggcgatggatctccacgaatatcaagca
gcagaactttttgcacggtatgggattccggtcaaccgtgggatcgtggcccggactcca
gaggaagccagcgctgcagccgaacagttgggcggccgggtcgtggtgaaagcgcaggtc
cacgccggaggtcgcggcaaagccggtggaatccgcctggccgatgatccagtccaggcc
gaggctgttgcccggcagatcctcggtatggagattcgcgggcggatcgtccgcaaagtg
ctggttgcgccagcagtcgccttcgagcgggagtattacctgggggctgtgctcgatcgc
gatagtcgtcgcatcgtggtgatggcgagcagcgcgggcggtgtcgatatcgaggaagtc
gcccgcgaacgcccgaccgcgatcgtccgcgagcaggctgatcccttcctcggtttcctc
gacttccaggcgcggcggctcgccttccggctcggcatcgaaccggacctggtgcggggt
ttcgcgacgatcgctcggcaactctaccgcgctttcgtcgacaacgatgcttcgctggcg
gagatcaatccgctggtcctcacacaggatcgctcctggctcgccctcgataccaaggtc
gtgctcgacgacaacggattgttccggcatccggatctggccgaactccgcgaccccgag
gaggaagacccgctggagcgggaagcccggctggcagggatcagcttcgtgcgcctgaac
gggaccgtcgggtgcatcgtcaatggagcagggctctccatggcgacgatggacgccatc
aaactgtacggtggggagccagcgaatttcctggacatcggtggaggagcctcggcgcag
cgggtggcggcggctttgcggatcgtcgtcgctgatcccaacgtccgcgccattctggtc
aatatcttcgggggcatcacgcgcggcgatgtggtggcacaagggattctcgaggccctg
cgccaagtcgaggttcgcgtgccgatggtgatccgtctcgtcggaacgcgccaggaggag
gggcgtcgcctgctcgaggaagctggtttcacggtcgtggacacgatggaagaagcagcg
cagcgagccgtggcactcgcgcaaggtcagtga

DBGET integrated database retrieval system