KEGG   Thermomicrobium roseum: trd_1851Help
Entry
trd_1851          CDS       T00845                                 

Definition
(GenBank) putative peptidase
Organism
tro  Thermomicrobium roseum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1862922..1863983)
Genome map
AA seq 353 aa AA seqDB search
MLRDEQKSFLLRLLEAPSPSGFEEAAARIWREEASCFADDVWVDHNGNSYARLRADTPTV
LIEGHIDEIGLMVTHIDDQGFLWFRAIGGWDDQILTGQRVRILTRQGPILGVIGRKPAHL
LSEEEKGRASRIKDLWIDIGARDGNEAREVVRVGDPIVIEQPPIELRNGRLVARGLDNRM
GAFIALEALRALAAERPPLDVVALAATQEEISFLGARAAAFRLEPIVAIVIDVTHATDHP
DADKRGGGDVRIGGGPVLDRGSMVHPLVFERLLAAAEAEGITVTLSAAPTRTGTDADAIA
PARAGIPCGLVSVPNRYMHSPNELVSLDDLDAAIRLIARFVRDLGSSPDFRRQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgacgagcagaaatcgttcttgctgcggttgctggaggcccccagcccctcc
ggtttcgaggaagcggcagcgcgcatctggcgcgaggaagccagctgcttcgccgatgac
gtctgggtcgatcacaacggcaacagctacgcccgcttgagggcggacaccccgaccgtc
ctcatcgaaggccatatcgacgagatcggactcatggtcacccacatcgacgaccaggga
ttcctctggttccgcgccatcggcggctgggatgaccagatcttgaccgggcaacgagtc
cgcatcctcaccagacaaggcccgatcctcggcgtcatcgggcgcaaaccagcgcacctg
ctgtcggaggaagaaaaggggcgtgcaagccgaatcaaggatctgtggatcgatatcggt
gcgcgcgatggcaacgaggcacgagaagtcgtccgggtcggtgacccgatcgtcatcgag
caaccgcccatcgaattgcggaacggccggctggtggcgcgtgggctggacaaccggatg
ggtgccttcatcgcgctggaggcgctgcgggcgctcgccgctgagcgcccgcccctggat
gtcgttgcgctcgctgcgacgcaggaagagatcagcttcctcggtgcgcgggcagccgcc
tttaggctggaaccgatcgtggcgatcgtcatcgacgtgacgcacgcgaccgatcatccg
gatgccgacaagcggggcggcggcgacgtccgtatcggcgggggtcccgtcctggaccgc
ggctcgatggttcatccactcgtcttcgagcgcttgttggcggcagccgaagcggaaggg
atcacagtcacgctctccgctgctccgacccggaccgggaccgatgcggatgccatcgcg
ccggcgcgggccggtattccttgcgggctcgtctcggttcccaaccgctacatgcactcg
ccgaacgagttagtgagcctggacgacctcgacgccgcgatccgcctcatcgctcgcttc
gtccgggacctcggatcgagcccagatttccgccggcagtga

DBGET integrated database retrieval system