KEGG   Thermomicrobium roseum: trd_1851Help
Entry
trd_1851          CDS       T00845                                 

Definition
putative peptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tro  Thermomicrobium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    trd_1851
Enzymes [BR:tro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     trd_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1862922..1863983)
Genome map
AA seq 353 aa AA seqDB search
MLRDEQKSFLLRLLEAPSPSGFEEAAARIWREEASCFADDVWVDHNGNSYARLRADTPTV
LIEGHIDEIGLMVTHIDDQGFLWFRAIGGWDDQILTGQRVRILTRQGPILGVIGRKPAHL
LSEEEKGRASRIKDLWIDIGARDGNEAREVVRVGDPIVIEQPPIELRNGRLVARGLDNRM
GAFIALEALRALAAERPPLDVVALAATQEEISFLGARAAAFRLEPIVAIVIDVTHATDHP
DADKRGGGDVRIGGGPVLDRGSMVHPLVFERLLAAAEAEGITVTLSAAPTRTGTDADAIA
PARAGIPCGLVSVPNRYMHSPNELVSLDDLDAAIRLIARFVRDLGSSPDFRRQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgacgagcagaaatcgttcttgctgcggttgctggaggcccccagcccctcc
ggtttcgaggaagcggcagcgcgcatctggcgcgaggaagccagctgcttcgccgatgac
gtctgggtcgatcacaacggcaacagctacgcccgcttgagggcggacaccccgaccgtc
ctcatcgaaggccatatcgacgagatcggactcatggtcacccacatcgacgaccaggga
ttcctctggttccgcgccatcggcggctgggatgaccagatcttgaccgggcaacgagtc
cgcatcctcaccagacaaggcccgatcctcggcgtcatcgggcgcaaaccagcgcacctg
ctgtcggaggaagaaaaggggcgtgcaagccgaatcaaggatctgtggatcgatatcggt
gcgcgcgatggcaacgaggcacgagaagtcgtccgggtcggtgacccgatcgtcatcgag
caaccgcccatcgaattgcggaacggccggctggtggcgcgtgggctggacaaccggatg
ggtgccttcatcgcgctggaggcgctgcgggcgctcgccgctgagcgcccgcccctggat
gtcgttgcgctcgctgcgacgcaggaagagatcagcttcctcggtgcgcgggcagccgcc
tttaggctggaaccgatcgtggcgatcgtcatcgacgtgacgcacgcgaccgatcatccg
gatgccgacaagcggggcggcggcgacgtccgtatcggcgggggtcccgtcctggaccgc
ggctcgatggttcatccactcgtcttcgagcgcttgttggcggcagccgaagcggaaggg
atcacagtcacgctctccgctgctccgacccggaccgggaccgatgcggatgccatcgcg
ccggcgcgggccggtattccttgcgggctcgtctcggttcccaaccgctacatgcactcg
ccgaacgagttagtgagcctggacgacctcgacgccgcgatccgcctcatcgctcgcttc
gtccgggacctcggatcgagcccagatttccgccggcagtga

DBGET integrated database retrieval system