KEGG   Thermomicrobium roseum: trd_1894Help
Entry
trd_1894          CDS       T00845                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tro  Thermomicrobium roseum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_1894 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_1894 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    trd_1894 (thrC)
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     trd_1894 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1903469..1904704
Genome map
AA seq 411 aa AA seqDB search
MLESTLTHLVCTGCQRTVSADEWHGTCPDCGHVLAARYDLERARWTFRPAELAARPWTLW
RYAELLPVCDPRFRLTLGEGGTPLLPAPRLARTLGLRRLWLKDESRNPTGSFKSRGLAVA
VSRAIELGARAVALPSAGNAAAALSAYAARAGIPAFVFLPMDTPPSIVRECLAYGARVYR
VRGLITDCGRLVRRFAAERGWADLSTLREPYRAEGKKTMGFELVEQLGWRLPDVIVYPTG
GGTGIVGMEKAFAELAALGLLAGSRARFVIVQPEGCAPLVRAFHEGATRARPWEGAQTIA
PGLRVPATIGDELVLAAVRASGGTAVAVSDQELLEGTRILATDEGVLVSPEAGATVAAVR
QLRANGWLAPDAEVVLFLTGSGLKHPELLPADEQCPVLEPDADSLPDPPVG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagagcacgctcacgcatctcgtctgtaccgggtgccagcgcaccgtctcggct
gacgaatggcatggaacgtgcccggattgcggtcacgtcttggctgctcgctacgatctg
gagcgagcccgctggacttttcgtcctgccgagctggctgctcgcccctggacactctgg
cgctatgcggaactcctgccggtgtgcgatccccgcttccggctcacgctgggcgagggt
ggcacaccgctccttcccgcgccgcggctcgctcgtacgttggggttgcggcggctttgg
ctgaaggacgagagtcggaaccccaccgggagcttcaagtctcgcggtctggccgtcgcg
gtgagtcgggcgatcgaactcggtgctcgcgcggtcgccttaccatcggccgggaacgct
gctgccgcgctcagcgcctatgcagcgcgcgccggcattcctgctttcgtctttctcccg
atggatacgccgccgagcatcgtccgggaatgcctggcctacggtgctcgggtctaccgc
gtgcgtggcctcatcaccgattgcgggcgcctcgtgcgtcgcttcgcagccgaacgcggc
tgggccgatctctcgacgctccgcgagccctaccgtgccgagggcaagaaaacgatgggg
ttcgaactcgtcgaacagctcggttggcgccttcccgacgtcatcgtttatccgaccggt
gggggaaccggcatcgtcggtatggagaaggccttcgccgaactcgcggcgctcgggctg
ctcgctggttcacgtgcgcgtttcgtcatcgtccagccagaggggtgcgcaccactcgtg
cgggcctttcacgagggcgccacccgggcacgaccgtgggaaggagcgcagacgatcgcg
cccggcctccgtgtcccagcgaccatcggggacgagctcgttctcgcagctgtacgggcg
agcggtggcacagcggtagcggtgagcgatcaggaacttctcgaggggacgcggatcctg
gcgaccgacgagggcgtgctcgtctcgccggaggccggggcgaccgtcgcggcggttcgg
cagctcagggccaacgggtggctcgcgcccgatgccgaagtagtgctcttcctgaccggc
agcgggctcaagcatccggaactcctgcctgccgacgagcagtgcccggtcctcgagccg
gacgctgactcgctgcccgatccgccggtcggctga

DBGET integrated database retrieval system