KEGG   Thermomicrobium roseum: trd_1932Help
Entry
trd_1932          CDS       T00845                                 

Gene name
treY
Definition
putative fusion of 4-alpha glucanotransferase and maltooligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tro  Thermomicrobium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    trd_1932 (treY)
Enzymes [BR:tro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     trd_1932 (treY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1945469..1947463
Genome map
AA seq 664 aa AA seqDB search
MTTRQALRQLAREAGIQLAYRDLAGQRQVASDAALLAVLRALGFPIGTPEEAPALLAEWR
QARLARRCEPVQVWRADRGTPRLQLVLPAFQEGRFELVVQREDGAVLELLPAERRWSQHQ
VGQSGIPELPGYRVELALPYEFPLGYHEMVIRCPDGQEARTLLIVRPPTVALPRAVGIER
TWGNFLPLYALWRDEPGDGATYTRLDELVAWTRERGGEFVGTLPLLPTFLGEHPYDPSPY
APVSRLFWSEFFVDPGWSPFPELVRASPLVVSPDEQGNRFVDYRATWRERFQMLAVLARE
VARHERARSEVEAWLAQRPLVSDYARFRAAVDQGEHLPPPRQYREQDQGLDEAAWIYVVA
QWLANQQLAAVGKERLYLDLPLGVHPEGFDVWYWPELFAQGASAGAPPDPFFAGGQVWGF
PPPHPERMREDGYRYLRAVLAHHLRAARLLRIDHVMGFHRLYWVPAGASGREGVYVRYPA
EEFYAILAIESQRAGCAVVGEDLGTVPRAVRQAMRRNGLLRMYVLPFERRDGQFTEPAPD
VVASLVTHDLPPFVAIWDEWGPGIQEAVLGWLAERGSLPESERDRRAAVLLGVLHFLAES
PAAVVVVNVEDLWFEREPQNRPGTGLEMPNWRRLARVGLASFTRDPFVTRALAIVETARK
GGGG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgccaggccttgcgccagctggcgcgcgaggcgggtatccagttggcgtat
cgcgatctcgctggacagcgtcaggtggcgagcgatgcggccctgctcgctgttctgcgc
gcgctcggttttcccatcggcacgccggaggaggcaccagccttgctcgcggagtggcgg
caggcacggctggctcgtcggtgcgagccggtccaggtgtggcgagccgaccgcggtacg
ccgcggctccagctcgtgcttcccgcgttccaggaagggcgtttcgaactcgtcgtccag
cgcgaggatggagcggtgctggaactgctaccagctgagcgacgctggtcgcagcaccag
gtcgggcagtccggcatccccgagctgcctggatatcgggtggaactcgccctgccgtac
gaattccctctcggctaccatgagatggtgattcgttgtccggatggccaggaggcgcgg
acgctgctcatcgtccgtccaccgacggtggcgctgcctcgcgcggtcggaatcgaacgg
acctggggaaactttctgccgctctatgcgctctggcgcgacgagccgggtgacggcgcg
acctacacgagactcgacgaactcgtcgcctggacgcgcgaacgcggtggggaattcgtc
ggaacgctcccgctgctcccgaccttcctgggcgagcacccttacgacccgagtccctat
gcaccggtcagtcggctcttctggagcgagttcttcgtcgatccaggctggtctcctttt
cccgagctggtgagggcgagcccgttggtcgtgtctccggatgagcaggggaatcggttc
gtcgattaccgggcgacctggcgggagcgcttccagatgctggccgtactggcgcgggag
gtcgctcggcacgagcgggcgcggagcgaggtggaagcatggctggcccagcggccgctg
gtatcggactacgccagattccgcgcggcggttgaccagggtgagcacctgcccccacct
cgccagtaccgcgagcaggaccagggtctggatgaggccgcgtggatctatgtggtcgcc
cagtggctggcgaaccagcagctggctgccgtggggaaggagagactctacctcgatctc
ccgctcggcgtgcacccggaagggttcgatgtgtggtattggccggaactcttcgctcag
ggggccagcgctggtgctccgcccgatcccttcttcgctggggggcaagtgtggggattc
ccgccgccgcatccggagcggatgcgggaggacggctatcgctacctgcgagcggtgctg
gcacatcacctgcgggcagcgcgcctgcttcggatcgatcacgtgatgggtttccatcga
ctctactgggtgccggccggagcgagcgggcgcgaaggggtctacgtccggtatccggcc
gaggagttctacgccatactggcgatcgaaagccagcgtgccggttgtgccgtcgtcggg
gaagatttgggcacggtgccgcgggcggttcgccaggcgatgcggcgcaatggcttgctc
cgcatgtacgtgctgccgttcgagcgccgggacggtcagttcaccgagccggcgcccgac
gtcgtggcgagtctggtaactcatgatctgccaccgttcgtcgccatctgggatgagtgg
gggccgggtattcaggaagcggtgctcggctggctggccgagcgtggttcgctacccgag
tcggaacgcgatcgccgagcagcggttttgctcggcgtgctccactttctggcggagagc
ccggcggcggtcgtggtggtcaacgtggaagacctctggttcgagcgggagccgcagaac
cgccccggaacggggctggaaatgccgaactggcggcgcctggcccgcgtcggcttggcg
agcttcactcgtgatccgttcgtcacgcgtgcgctcgccatcgtcgagacggcacggaag
ggaggagggggatga

DBGET integrated database retrieval system