KEGG   Thermomicrobium roseum: trd_1933Help
Entry
trd_1933          CDS       T00845                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tro  Thermomicrobium roseum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tro00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947460..1949403
Genome map
AA seq 647 aa AA seqDB search
MTGRPVGPACHDRSLLTEHDVYLFSEGTWLRAYEKMGAHPCVLDGEEGVYFAVWAPNAER
VSVVGDFNDWTPGKHPLCPRGSSGIWEGFIPGLGPGARYKYHLVSRYHGYQVFKADPYGF
RHECPPGTASIVWDLTYEWQDGDWMRRRGRANALDAPMQIYEVHLGSWMRVPEEGNRWLT
YREIAPKLAEHVQRMGFTHVEFLPVMEHPFYGSWGYQITGYFAPTARYGTPQDFMALVDA
LHQQGIGVILDWVPSHFPTDEHGLVFFDGTHLYEHADPRKGFHPDWHTAIFNYGRNEVRT
FLLSSAMFWLDRYHADGLRVDAVASMLYLDYSRGPGEWIPNEYGGRENLEAIAFLRRLNE
EIYRYYPDVQTIAEESTAWPMVSRPTYLGGLGFGLKWDMGWMHDTLLYFSRDPIYRKYHH
HELTFRMLYAFTENFVLPLSHDEVVHGKGSLIAKMPGDDWQKFANLRLLYGYQYTQPGKK
LLFMGAELAQWREWDHETSLDWHLLEYAPHRGVQRWLADLNRLACREPALHERDVWPDGF
EWIDCNDAENSVLVYLRKSCDPADTLLIVCNFTPVPRQNYRVGAPAPGFWRELLNSDARE
YGGSGWGNLGGVETVPVPWHGRPYSLVLTLPPLAILIFKRATEGSVR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactggtcggccagtaggcccggcgtgccatgatcgctcgctgctgacggagcacgat
gtctacttgttcagcgaagggacatggctccgtgcctacgagaaaatgggcgctcatccc
tgcgtgctggatggcgaggaaggagtctacttcgcggtctgggcaccgaatgccgagcgc
gtctccgtggtgggcgacttcaacgattggacgccgggcaagcatccgctctgtcctcgg
ggctcttccggtatctgggaggggttcatcccaggactcggcccgggagcccgctacaag
tatcacctcgtttctcgctatcatggctaccaagttttcaaggcggatccttacggtttc
cgacatgaatgtccacccggtactgcctcgatcgtctgggatctcacctacgagtggcag
gacggcgactggatgcgacggcgcgggcgagccaatgccctggatgcgccgatgcagatc
tacgaggtgcacctcgggtcctggatgcgggtcccggaagaagggaaccgctggctgaca
taccgggaaatcgctcccaagctcgcggagcacgtgcagcgcatgggcttcacgcatgtc
gagttcttgccggtcatggagcatcccttctacggttcttggggttaccagatcaccggt
tacttcgcaccgactgcgcgctacggcacacctcaggatttcatggcgctcgtcgatgcg
ctgcaccagcagggaatcggggtgatcctggactgggtcccctcccactttcccactgac
gagcacgggctcgtcttcttcgacgggacccacctctacgagcacgctgacccgcgcaag
ggattccatccggactggcacaccgcgatcttcaactacgggcgcaacgaagtacgcacg
ttcctcttgtccagcgcgatgttttggctggaccgctaccacgctgacgggctgcgcgtc
gatgcggtggcctccatgctctatctcgattactcgcgcggcccgggggagtggattccc
aacgagtacggtgggcgcgagaacctggaagcgatcgccttcctgcgccgcctgaacgag
gagatttaccggtactatccagatgtccagacgatcgccgaggaatcgactgcctggccg
atggtctcccggccgacctatctcggtgggctgggcttcgggctgaaatgggacatggga
tggatgcacgatacgttgctctacttcagccgcgacccgatctatcgaaaataccaccat
cacgaactcacgttccgtatgctctatgcctttacggagaacttcgtgcttcccctctcg
cacgacgaggtggtgcacgggaagggctcactcatcgccaagatgcccggtgacgattgg
cagaaattcgccaacctgcgactgctttacggctaccagtacacccagcctggcaagaag
ctcctgttcatgggagcggagttggcccagtggcgggagtgggatcacgagacgagtctc
gactggcatctcctggagtacgcgcctcatcgtggggtccaacggtggctggctgatctg
aaccgactcgcgtgccgcgaacccgcgctccacgagcgcgatgtgtggcctgacggattc
gagtggatcgactgtaacgatgccgaaaacagcgttctcgtttacttgcggaagagctgt
gacccagcggacaccctgctgatcgtctgcaatttcacccccgtgccgcgacagaactac
cgtgtcggtgctccggctcccggattctggcgcgagttgctcaacagcgatgcccgcgag
tacggggggagtggctggggcaatctgggtggtgtggagactgtgccggttccctggcat
ggccgaccgtactcgctcgtcctcaccctgccgccgctcgcgatcctgatcttcaagcgt
gcgaccgaggggagcgtccggtga

DBGET integrated database retrieval system