KEGG   Thermomicrobium roseum: trd_A0194Help
Entry
trd_A0194         CDS       T00845                                 

Definition
nitrous-oxide reductase (N(2)OR) (N2Oreductase) (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
tro  Thermomicrobium roseum
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    trd_A0194
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     trd_A0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:complement(176069..178183)
Genome map
AA seq 704 aa AA seqDB search
MFAPSFPDETENGNEERQGPHRMSRGGSTMAERQDRPPSSIGQRKVSRRGLLGTAAGLSA
GALLASCSVFQRKEETPKLGASADEIIKARQLTPEDVTAALMTYVPSGKYDEYLMFSSTG
HGGQVLVHGLPSMRLLKVIAVFTPEPWQGYGYGGYTNEVLEGGYFHGKPILWGDTHHPAL
SETNGEYDGEFLFINDKANGRVAVIDLRDFETKQIVKNPLLVNEHGGCFVTPNTEYVLEA
DQYSVPLGGVYAPITEYKEKYRGVLTFWKFDRQKGRIVPEQSFAIETPPYWHDLADAGKG
PSHGWAFWNSINTELAIPGIAEGRPALEIATTQRDMDYLHVVNWKKAEEVIAAGKYEEIN
GFKVIRMDVAAKEGVLFLIPEPKSPHGVDVTPGGDYIVVAGKLDPHVTVYSFAKIQQAIQ
AGQWDTDEYGIPVLPFEQCVEAQVELGLGPLHTQFDDQGYAYTSLFLDSAVAKWALGKPY
RDDGWKLVEKLPVQYNIGHLAAVEGDTTKPAGRFLVVHNKWSVDRYASLGPLLPQNAQLV
SIAPNQPMRVLYDCPIGIGEPHYAQIIKRERIKSWEIYPEVGWNPHTQSTDPNAVLKVGE
ERIERRGKTVEIWGVLLRSQIRPDLIEVEQGDEVIWHLTNIERAKDATHGFALGGYNINL
SLEPGETQTIRFKADIPGTFPFYCTEFCSALHLEMMGYFLVKPT
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgctccgtcgttccccgacgagactgaaaacgggaacgaggagcggcaaggaccg
caccggatgagtcgaggaggatcgacgatggctgaacgacaggatcgaccaccgtcctcg
atcggtcagcgtaaggtgagtcggcgcggccttctgggaaccgcggctggtctttcggcg
ggtgcgttgctggccagttgcagtgtcttccagcgcaaagaagaaacacccaagctgggg
gcgagcgccgacgagatcatcaaggcacggcagctgacaccggaggacgtgacggccgcg
ctcatgacgtatgttccctccgggaagtacgacgagtacctgatgttctcctccaccggc
cacggtggccaggtgctcgtacacggtctcccctcgatgcggctcctcaaggtgatcgcg
gtcttcacccccgagccctggcagggctatggctacggcgggtacacgaatgaggtcctc
gagggcgggtacttccacggtaaaccgattctctggggcgatacccatcatccagccttg
agcgagacgaacggggagtacgacggcgagttcctgttcatcaacgacaaggcgaacggt
cgcgtcgctgtcatcgacctgcgcgatttcgagacgaagcagatcgtcaagaacccgctt
ctggtgaacgagcacggcggctgcttcgtcactccgaacaccgagtacgtgctggaggcc
gaccagtactcggtgccgctggggggcgtctacgcgccgatcaccgagtacaaggaaaag
tatcgcggcgtcctcacgttctggaagttcgatcggcagaagggccgcatcgtccccgag
cagtcgttcgcgatcgagacgccgccctactggcatgacctagccgatgccggcaaggga
ccgtctcacggttgggccttctggaactcgatcaacacggaactcgcgattccgggtatc
gccgaaggccggccagccctggagatcgcgacgacccagcgcgacatggactatctccac
gtcgtcaactggaagaaggcagaagaggtcatcgcggccggcaagtacgaggagatcaac
ggtttcaaggtcatccggatggacgtcgcagcgaaggaaggcgttctcttcctgatcccg
gagccgaagagcccgcacggtgtagacgtgacgccaggtggggactacatcgtcgtggcc
gggaagctcgatccgcacgtgacggtctacagcttcgccaagatccagcaagcgatccag
gctggccagtgggataccgacgagtatggcattcccgtcttgccgttcgagcagtgtgtg
gaagcacaggtggagctggggctcggtccgctccatacccagttcgacgaccagggttac
gcctacacgagcttgttcctggacagcgccgtggcgaagtgggcactcggcaagccatat
cgtgacgatggctggaagctcgtcgagaagctaccggtgcagtacaacatcggccacttg
gccgctgtcgagggagatacgaccaagccggccggtcgcttcctggtcgtccacaacaag
tggtcggtcgatcgttacgccagcctcgggccgcttctgccgcagaatgcgcaactggtc
tcgatcgccccgaatcagccgatgcgagtcctctacgactgcccgatcggtatcggcgaa
ccgcactacgcccagattatcaagcgggagcggatcaagtcgtgggagatttatcccgag
gtcggctggaatccgcacacgcaaagcaccgatcccaacgccgtgctcaaggtcggcgag
gagcggatcgagcgccgcggcaagacggtcgagatctggggtgtgctcctgcgcagccag
attcgtcccgatctgatcgaggtggagcagggggacgaggtgatctggcacctcaccaac
atcgagcgtgctaaggatgccacgcacgggttcgccctcggtggctacaacatcaacctc
agtctcgagccgggcgagacgcagaccatccgcttcaaggccgatatcccaggcaccttc
ccgttctactgcacggagttctgctccgccctgcatctcgagatgatgggctacttcctg
gtgaagccgacctga

DBGET integrated database retrieval system