KEGG   Thermomicrobium roseum: trd_A0200Help
Entry
trd_A0200         CDS       T00845                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tro  Thermomicrobium roseum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    trd_A0200
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_A0200
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    trd_A0200
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     trd_A0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
unnamed:complement(181915..183282)
Genome map
AA seq 455 aa AA seqDB search
MSAAETVKFVLTEADLPTHWYNLAADLPTLPPPPIHPGTGEPVGPADLEPVFPMELILQE
VSRERWIAIPGPVLDVYRLWRPTPLFRARRLERVLGTPARIYYKYEGVSPAGSHKPNTAV
AQAYYNKQAGVKRLTTETGAGQWGSSLAMACAFFGMELKVYMVRASYLQKPYRRILMETW
GAQCVPSPSPDTASGRRFYEQDPEHPGSLGIAISEAVEDAASRADTKYSLGSVLNHVLLH
QTVIGLEALRQFELAGDYPDVIFGCVGGGSNFAGLTFPFVRDKLQGKDVRIVAVEPAACP
SLTRGVYTYDFGDTARTTPLLKMHTLGHTFIPARIHAGGLRYHGMAPLVSHLYEHGLIEA
IALPQTKVFEGAVLFARAEGIIPAPESAHAVRAAIDEARRCAETGEEKAILIGLSGHGHF
DLAAYEAYLAGKLEDYEYPEEAVRQALAELPKVSG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcagcagagaccgtcaagttcgtgttgaccgaggccgatctcccaacgcactgg
tacaacctggccgccgatctccccacgcttcccccaccgcccatccacccagggaccggg
gaaccggtgggtccggccgacctcgaacccgtctttccgatggaactcatcctccaggaa
gtgagccgcgagcgctggatcgcgatccccgggccggttctcgacgtctaccgactctgg
cgaccgacgccactcttccgagcccgtcggctcgagcgcgtgctcggtacaccagcgcgc
atctactacaagtacgaaggggtcagcccggccgggagtcataagccgaacacggcggtc
gcccaggcctactacaacaagcaggccggcgtgaagcggctcaccaccgagaccggagcg
ggtcagtggggaagctcgctcgccatggcctgcgccttcttcggtatggaactcaaggtg
tatatggtgcgggccagctatctccagaagccgtaccggcgtatcctgatggagacctgg
ggagcccagtgcgtccccagccccagtcccgacaccgcgtccggccggcgcttctacgag
caggatcccgagcatccgggaagcctcggaatcgccatttccgaggcggtcgaggacgca
gcctcgcgcgcggacaccaagtactcgctcgggagcgtgctcaaccacgtgctcctgcac
cagacggtcatcgggctggaggcgctccggcagttcgagctggccggtgactacccggac
gtcatctttggctgtgtcgggggcggttccaacttcgctggtctcacttttcccttcgtg
cgggacaagcttcaggggaaggacgtgcgcatcgtcgccgtcgaaccggccgcctgcccg
tcgctcacccgcggcgtctatacctacgacttcggcgatacggcacggacgacgccgctc
ctcaagatgcatacgctcggccacaccttcatccctgcccggatccacgccggtggcttg
cgctaccatgggatggcaccactggtcagccacctctacgagcacggactgatcgaggcg
atcgcgctcccgcagaccaaggtgttcgagggagccgttctgttcgcccgtgccgagggg
atcattcccgctcccgaatcggcacatgccgtgcgcgctgcgatcgacgaggcccgccgc
tgcgccgagactggcgaagagaaggcgatcctgatcgggctgagcgggcacggccacttc
gatctggcagcctacgaggcctacctcgccgggaagctggaagactacgagtatcccgag
gaagcagtccgccaggcgctcgccgagctgccgaaggtcagcggctga

DBGET integrated database retrieval system