KEGG   Thermomicrobium roseum: trd_A0358Help
Entry
trd_A0358         CDS       T00845                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tro  Thermomicrobium roseum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    trd_A0358 (glpK)
Enzymes [BR:tro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     trd_A0358 (glpK)
Exosome [BR:tro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   trd_A0358 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:347068..349200
Genome map
AA seq 710 aa AA seqDB search
MSVCHRRCDPGDWAHQWSVSRSCRHARFGLSRVVLPECCPHHIIGSIVEAFLVAVLVRFA
RLPQPTIFDGAGFEGTALSTARAIRDDLSSYLVTDIIDAARRVFGVRGILPNELVSGVGP
LLWNPCLEVSGCPVTARPGMASVVAGFRGWAARRRSGRLPVKEALTDGTTRCRSSGRTPA
ASWAPCCSGSHWCERGALEKSERGTVMSRFALAIDQGTTSTRAVIFDRESNVIAMDQREH
QQIYPQPGWVEHDPMEIRERTQQVVRTALERAGIGGGDIAAVGITNQRETSVVWNRHTGQ
PYRNAIVWQDTRTDQLCAQLERDGYGPMFRERTGLPISTYFSGPKIRWLLESDPEIRAAA
EKGDALFGNIDTWLIWWLTGGPNGGAHVTDVSNASRTMLMNLQTLDWDDELLRALQIPRQ
MLPAIRSSSDPNAYGYTVADGPLGARVPVCGDLGDQQAALVGQAGLKPGMAKNTYGTGCF
VLLNTGTEIVPSKYGLLTTVAYRFGDGPCVYALEGSIAITGALVQWLRDNLGLISQSAEV
EELARSVEDNGGIYFVPFFSGAFAPYWRADARGVIVGLTRFVNRGHVARAALEATAYQTR
DVVDAMVADSGIELAELRVDGGMVQNELLMQFQADILGVPVIRPVVTETTSLGAAYAAGL
AVGYWANEQEIAQYWKEARRWNPQMGAEQRDALYRGWKKAVERSFGWVEL
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtttgccatcgtcgttgcgaccctggcgactgggcgcatcagtggagtgtctct
cgttcctgtcgtcacgctcgctttggcctttcccgggtagttctcccggagtgttgcccg
caccatatcatcggttcgatcgtcgaggcgttcctcgttgcggtgctggtccggttcgct
cgtctgcctcagccgacgatattcgatggtgctgggttcgaggggacagcgctctcgact
gcgcgagctatccgcgacgatctatcgtcgtatctggtcactgacatcatcgacgcagca
agacgcgttttcggtgttcgggggatcttgcccaatgaactggtgagtggcgtggggccg
cttctgtggaatccctgcttggaggtatcgggatgtcccgtcaccgctcgaccaggtatg
gcatcggtcgtggccggatttcggggatgggcagcgcgcaggcgatctggccgactcccg
gtgaaggaagctctgaccgacggaacgactaggtgtcggtcatcgggcagaacaccggcg
gcatcttgggctccctgctgttccggctcacactggtgtgagcgaggagcgttggagaaa
tcggagagaggtacggtcatgagtcgcttcgctttggcgatcgaccaagggacaacgagc
acgcgagccgtgatcttcgaccgcgagagcaatgtcatcgcgatggatcagcgcgagcat
cagcagatttacccgcaaccgggatgggtcgaacacgatccgatggagattcgggaacgc
acgcagcaggtggtgcgaaccgctctcgagcgtgcggggatcggtgggggtgacatcgcg
gctgtcgggatcaccaaccagcgcgagacgtccgtggtctggaatcgccatacgggccag
ccgtacaggaacgccatcgtgtggcaagatactcgcaccgatcaactgtgtgcccagctg
gagcgcgacgggtatggtcccatgttccgtgagcggaccggcttgccgatcagcacctac
ttttccggtcccaagatccgctggctcctggagagtgatccggaaatccgcgctgcggcc
gagaagggggatgcgctcttcggcaatatcgatacgtggctgatctggtggctgaccggc
gggccgaacggtggggcacacgtcacggacgtctccaatgcgagccggaccatgctgatg
aacttgcagacgttggactgggatgacgaactcctccgcgccctgcagatcccccgccag
atgttgccggctatccggtcctcgtccgatccgaacgcctacgggtacacggtagccgac
ggtccgctcggtgcgcgggttccggtgtgcggggatttgggtgaccagcaagcggcactc
gtcggacaagcaggcctcaagccgggaatggctaagaatacctacggcactggttgtttc
gttttgctcaacaccgggacggagatcgtcccgtccaagtacggtttgctgacgacggtc
gcgtaccgtttcggggatggcccctgcgtgtatgcgctggagggatcgatcgcgatcacc
ggtgcgctggtccagtggctacgcgacaatctggggctgatcagccaatcagccgaggtc
gaggaactcgcacgctcggtcgaggacaatggcgggatctacttcgttcccttcttctcc
ggtgccttcgcgccgtactggcgagctgatgcgcgaggggtgatcgtcggtttgacccgc
ttcgtcaatcgggggcatgtggcgcgggcagcgctggaggcgacggcctaccagacgcgc
gacgtcgtcgatgcgatggtggcggactcggggatcgagctggcagagctgcgcgtcgat
ggcggcatggtgcaaaacgaacttttgatgcagttccaggcggacatactgggtgtaccg
gtgatccgtccggtcgtgacggagacgacctcgctcggcgcggcttacgcggccgggctg
gcggtcggctactgggcaaacgagcaggaaatcgcccaatactggaaagaggccaggcgc
tggaatccacagatgggagctgaacagcgcgacgcgctttaccgaggctggaagaaagct
gtcgagcggagctttggttgggtggagctgtag

DBGET integrated database retrieval system