KEGG   Thermomicrobium roseum: trd_A0505Help
Entry
trd_A0505         CDS       T00845                                 

Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tro  Thermomicrobium roseum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    trd_A0505
Enzymes [BR:tro01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     trd_A0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:495551..496951
Genome map
AA seq 466 aa AA seqDB search
MERPRTLGELRESGYRVLPVREEMRKNLIAKIQAGEPIFPGIIGYEETVIPQVENAILAG
QDIIFLGERGQAKTRMARLLVNLLDEEIPIVAGSEVNDNPFDPISKYARDLIAEMGDETP
IAWIRREERYAEKLATPDTTIADLIGEVDPIKVAEGRYLSDELTIHYGLIPRTNRGIFVI
NELPDLAERIQVGLLNIMEERDVQIRGYRVRLPLDVFVVASANPEDYTNRGRIITPLKDR
FGAQIRTHYPRTIEHEIAIMEQERMPVEVPGITVTVPQYMREIVAEITHLARRSPDISQR
SGVSARMSVANYETLISNAVKRALRLGEKHAVPRISDLPALVASTLGKLEFETLGEVQED
RIIEKLINGAVVATFNRYFSVRDFDDLILAFENGLTVEASDLQPAMRYVHQVAHIESLRR
ATQRLGATGDPALVAAAVEFVLEGLHLNRRVNKERATGGGAARYRS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggagagaccacgaacgttaggcgagctgcgcgagagcggctaccgcgtccttcccgtt
cgggaagaaatgcgcaagaacctcatcgccaagattcaggcaggtgaaccgattttccct
ggaatcatcgggtacgaggagacggtcatcccacaggtggagaacgccattttggctggg
caggacatcatcttcctcggtgagcgcggccaggccaagacgcgcatggcgcgtctgctc
gtcaaccttttggacgaggagattccgatcgtcgcgggcagcgaggtgaacgataacccg
ttcgaccccatctcgaagtacgcgcgggatctcatcgcggagatgggcgacgagacgccg
atcgcttggatccggcgcgaggagcgctacgccgagaagctggcgacgccggacacgacg
atcgccgatctgatcggtgaggtcgacccgatcaaagtggcagagggacgttatctctcc
gacgagctcacgatccactatggcctgatcccgcggaccaatcgcggcatcttcgtcatc
aacgagcttcccgacctggcggagcggatccaggtggggttgctcaacatcatggaagag
cgtgacgtgcagatccggggctatcgcgtgcgactcccgctcgatgtcttcgtcgtcgcc
agcgccaatccggaggactacacgaatcgcgggcgaatcatcacccccctcaaggatcgc
ttcggggcgcagatccggacccattacccgcggactatcgagcacgaaatcgcgatcatg
gagcaggagcggatgccggtcgaggtgcccggcatcacggtgacggtgccgcagtacatg
cgcgagatcgtcgccgagatcacgcacctcgcccgccggagtccggatatcagccagcgc
tccggtgtcagcgcgcgtatgtcggtggccaattacgagacactgatcagcaatgcggtc
aagcgggctctccgcttgggcgagaagcacgcggtgccgcggatcagcgacttgccggcg
ctcgtcgcctccacgctcgggaagttggagttcgagacgctgggcgaagtgcaggaggat
cggatcatcgagaagttgatcaacggggcagtcgtggcgactttcaatcgctacttctcg
gtgcgagacttcgatgatctcattctcgccttcgagaacggcttgaccgtggaggcctcc
gatctgcagccagcgatgcggtatgttcatcaggtcgcccatatcgagagtctgcggcgc
gccacgcagcggctcggtgcaacgggggaccctgcgctggtcgcggcagcagtcgagttc
gtgctcgagggactgcacctgaaccggcgcgtgaacaaggagcgagccaccggaggtggt
gcggcccgctaccgaagctga

DBGET integrated database retrieval system