KEGG   Thermomicrobium roseum: trd_A0539Help
Entry
trd_A0539         CDS       T00845                                 

Definition
alcohol dehydrogenase (ADH) (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
tro  Thermomicrobium roseum
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    trd_A0539
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     trd_A0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:531580..532623
Genome map
AA seq 347 aa AA seqDB search
MLAARLYRYDPAMQEELRLETVPDPTIRQPDEVIVRIVGAGLCRTDLHIIEGVWRPILDP
EGKLLPYTLGHENTGIVEAVGSAVRNVRVGDRVICHPQATCGLCLGCRVGEDMYCTSARF
PGLDSDGGFAQYLVTTERALVKVPEDVDLVDIAPLADAGLTAYRAAKRASRIAPPDGWVV
IIGIGGLGHIALQVLRALAGVRIVAVDRSPLARERAGELGADHVLAGSPDLAAEIRELTG
GGAHVVLDFVGEQGVEQQSWQMLRKGGTHLIIGYGGTLEIPTVRMIFGELTVAGSLVGNY
KELVELIDLVARGKVRVFTQRYTLQEINRAIDDFKHGRYFGRAVITP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctgcgcgactgtatcggtatgatccggcgatgcaggaagagctgcgcctcgag
actgttcccgatccgacgatccggcaaccggacgaggtgatcgtccgtatcgtgggagca
gggctgtgccggaccgatctccacatcatcgagggggtatggcgcccgatcctcgatccg
gaaggaaagctgctcccgtacacgctcggacatgagaacacgggtatcgtcgaggcggtt
ggcagtgccgtgcgcaacgtgcgggtgggagatcgcgtgatttgccacccgcaggccacc
tgcgggctctgtctcggctgccgggtcggggaggacatgtactgcacgagcgcgcggttt
ccgggattggactcggacggtgggttcgcccagtatctcgtcacgaccgaacgggcgctg
gtgaaagtgcctgaggacgtcgatctggtggatatcgcgcccctggccgacgcggggctg
acggcctatcgagcagccaagcgggcgagccgcatcgcgccgccggatggttgggtggtg
atcatcgggatcggcggactcgggcacatcgctctccaggtcctgcgggcactggcgggg
gtgcggatcgtcgccgtcgatcgctcgccattggcgcgggagcgagctggcgagctcggg
gccgaccatgttctggctggtagtcctgatctggccgcggaaattcgggagctcaccggt
ggtggtgcgcacgtcgtgctcgacttcgtcggtgagcagggggtcgaacagcagagctgg
cagatgctccgcaagggcggcacccatctgatcatcggctatggggggacgttggagatt
ccgaccgtacgcatgattttcggcgagttgacggttgctgggagcctggttggaaactac
aaggagctggtcgaactgatcgatcttgtggctcgagggaaagtccgcgtgtttacgcag
cgctacacgctccaagagatcaaccgggcgatcgacgatttcaagcacggacggtatttc
gggcgggcggtgatcacaccgtag

DBGET integrated database retrieval system