KEGG   Thermomicrobium roseum: trd_A0661Help
Entry
trd_A0661         CDS       T00845                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tro  Thermomicrobium roseum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tro01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tro00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:650998..652806
Genome map
AA seq 602 aa AA seqDB search
MQAIHGRALVVDCSTGTAEPFPIPPAVSAAVLGGAGLASWLLLRFAPPRVDAWAPENPFV
LAAGPFIGTGLTTSSKLAIATTSPQTGFIGDSLTSSYLALVLRRTGFDALVVVGRAPRWS
VLFVDDDQVRLLPAEHLLGRDPEETAATLRSELGRDIRVAAIGRAGERLVRYAAVVNDGR
LAGRTGPGAVLGAKRIKAIAVRGTGRFPAVADPDGVHRAARQLATRSLGPETAKYRELGT
VANLAFFSRLGVLPTRNFQAGSFPAAEALSGERLVTQHRADRQACAACTVGCEHHFRTSD
GGPATTVRLEYETLFALGSLCGIEDPNVVLRAAALCDRYGMDAISAGGTIAWAMECVERG
VPLPGSPDEWPRFGDGASLLRTLEAIGERRGPLGALLAEGSRRAAAIIGHGSETWAMHVK
GLELPGYHPKRLRAMALGFAVTPRGACHNRTSAYEIDFSEDAPALAERIAQATARSEDRS
ALLDALPLCKFLRHCFDDFFVEAANLVRLVTGLSCDADELQRTGERIVTLKKLFNLRQGW
TRSDDTLPSRLLGPNGIDPAELDRLIRAYYRVRGWAADGSIPPERLRDLGLESLLDSVSI
GS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgatccacggtcgcgcactcgtcgtcgattgctccactggcactgctgaaccg
tttcccatcccgcctgccgtcagtgccgctgttctcggtggtgccgggctcgccagctgg
ctcctcctccgcttcgctccaccgcgggtcgatgcttgggcaccagaaaatcccttcgtt
ctcgcggctggcccgttcatcgggaccggactcaccacgtcgagcaagctcgcgatcgcg
acgacatccccgcagaccggcttcatcggggattccctcacctcgagctatctggcactc
gtcctgcggcggaccggcttcgatgccctcgtggtcgtgggcagggcgccgcgctggtcg
gtcctcttcgtcgacgacgatcaggttcgcctgttgccagctgagcatctgctcggacgc
gaccccgaggagactgcagccactctgcgcagcgaactcggccgcgacatcagagtcgcc
gcgatcggccgtgctggggaacgactcgtccgctacgcggcggtcgtcaacgacgggcgt
ctcgctggacgcaccgggccgggggctgttctcggggccaaacggatcaaggcgatcgcc
gtgcgcgggaccggacgatttccagcggtcgccgatccggacggagtccatcgggctgcg
cgccagctggccacgcgtagtctcggtcccgaaaccgccaagtatcgcgaactcgggact
gtggccaacctcgccttttttagccggctcggtgtcctcccgacccgcaacttccaggcc
ggatcgttccccgcggccgaggcgctttccggggagagactggtcacccagcaccgggct
gatcggcaggcgtgtgcggcctgcacggtcggctgcgagcatcacttccggaccagcgat
ggtggccccgcgaccacggttcgactcgagtacgagacactgttcgccctcggctcgctg
tgcggcatcgaggacccgaacgtcgtcctgcgggcagcagcgctctgtgaccgctacggg
atggacgccatcagcgctgggggaacgatcgcttgggcgatggaatgcgtcgagcggggt
gtccccttgccaggctcacccgacgagtggcctcgtttcggcgatggggccagcctcctg
cgcacgctggaagcgatcggagagcgccgcggcccgctcggcgctctcttggccgaaggc
tcgcggcgggctgctgccatcatcggccatggcagcgagacctgggcgatgcacgttaaa
gggctcgagcttcccggttaccaccccaaacggttgcgcgccatggcgctcggcttcgcg
gtcaccccgcgcggcgcgtgtcacaaccgaacgtctgcctacgagatcgacttctccgag
gacgcccccgctttggccgaacggatcgcgcaggcgaccgcccgcagcgaggatcgctcg
gccctgctcgatgcactgcccctctgcaagttcctccgccactgcttcgatgatttcttc
gtcgaagcggccaacctcgtccggctcgtgactggcctttcctgtgacgcagacgaactc
cagcggaccggcgagcgcatcgtcacgctcaaaaagctcttcaacctgcgccaggggtgg
acccgctccgatgatacgcttccatcgcgcctgctcggcccaaacggcatcgatccagcc
gaactggacaggctcatcagggcatactaccgtgtacgcggctgggcggccgatgggtcg
attccgccggaacgcctgcgcgatcttggattggaatcgttgctcgactccgtttcgatc
ggatcgtaa

DBGET integrated database retrieval system