KEGG   Thermomicrobium roseum: trd_A0754Help
Entry
trd_A0754         CDS       T00845                                 

Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tro  Thermomicrobium roseum
Pathway
tro00010  Glycolysis / Gluconeogenesis
tro00071  Fatty acid degradation
tro00350  Tyrosine metabolism
tro00625  Chloroalkane and chloroalkene degradation
tro00626  Naphthalene degradation
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_A0754
  Lipid metabolism
   00071 Fatty acid degradation
    trd_A0754
  Amino acid metabolism
   00350 Tyrosine metabolism
    trd_A0754
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    trd_A0754
   00626 Naphthalene degradation
    trd_A0754
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     trd_A0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DUF2610 3HCDH_N Methyltransf_25 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACM07214
UniProt: B9L4P0
Position
unnamed:740814..741818
Genome map
AA seq 334 aa AA seqDB search
MRAARYFGPHDFRLVEIDRPVPERGEVLLRVRAAGLCHSDLHIIFDELGGYPIPAPLTLG
HEICGEAVERGEGVTGIEIGRRYVVFGPVGCGNCRWCRSGRDNLCTESRWIGIARDGGYA
EYVTVPAQALVAVPDTVSDAEAAVATDAVLTSYHALLTVGRLQPGEGVAIIGVGGLGLNA
VQIASAFGAVVLALDIQERKLELARQHGAAIALDSRQLDPQNPPLDRPITLVADFVGTDQ
TKLLAQQLVARGGRIVLVGLGSVGGPLLGLRAVADEIAVLGSFWGTRQELATVLDLIARG
IIRPRVETHPLDEILTWVERLRAGEVESRVALVP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagcccgctatttcggtccccatgatttccgtctcgtcgagatcgaccgcccc
gttcctgagcgcggcgaggtgctcctgcgcgtccgcgcagctggcctctgccactccgac
ctgcacatcatcttcgatgaactcggtggttacccgattccggcacccctgacgctgggt
cacgagatctgcggtgaagccgtggaacgcggcgagggagtgaccggcatcgaaatcggt
cgccgctacgtcgtcttcggtccggtcggctgcggcaactgccgctggtgccgcagcgga
cgcgacaacctctgcaccgagagtcgctggatcggaatcgcccgcgacggcgggtacgcc
gagtacgtcacagtgcctgcccaggccctcgttgccgtgccggacactgtctccgacgct
gaggcagcggtcgcgaccgacgcggtcctcacgtcgtatcacgccttgctcacggtcggt
cgcctccagcccggggagggagtcgccatcatcggtgtcggcggcctcggcctcaatgcg
gtccagatcgccagcgccttcggcgccgtcgtcctggccctcgacatccaggagcggaag
ctggaactcgcccgccagcacggcgcagccatcgcgctggacagccggcagctcgatccc
caaaacccgcccctcgatcgacccatcacgctggtcgccgacttcgtcggcaccgaccag
accaagctgctcgcccagcaactcgtcgcccgcggcggacgcatcgtcctcgtcggcctg
ggcagcgtcggtggtccactcctcgggcttcgcgctgtcgccgacgaaatcgctgtcctc
ggctcgttttggggtacccgacaggaactcgcgactgttctcgacctcatcgcccgcggc
atcatccggccccgcgtggaaacgcacccgctcgacgaaatcctcacctgggtcgaacgg
ttgcgcgcgggtgaggtcgaaagccgcgtggccctggtgccctga

DBGET integrated database retrieval system