KEGG   Thermomicrobium roseum: trd_A0785Help
Entry
trd_A0785         CDS       T00845                                 

Gene name
panC
Definition
pantoate--beta-alanine ligase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
tro  Thermomicrobium roseum
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tro00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:tro00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
unnamed:767834..768682
Genome map
AA seq 282 aa AA seqDB search
MHLFRTIAELRIWRSQQASRSVGFVPTMGYLHEGHLALVRRARAENETVVVSIFVNPLQF
GPQEDYDRYPRDLDRDLYLLEREGVDAVFAPSVSEMYPSGFSTAVVVTGPIAERLEGEAR
PGHFRGVATVVTRLFGLVQPQRAYFGWKDAQQVLVVQRLVQDLALPVDIVPLPTVREADG
LAMSSRNVYLSPEERVAASAIPRALFAALERFRSGERAAAAFRELVQRTLTTTPVRLEYV
SVSDLETFQEVEYVERPALLLVAAWIGTTRLIDNVLLDPGAP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcttccggacgatcgctgaactccgcatctggcgttcccagcaggccagccgt
tcggttggcttcgtccccacgatgggctacttgcatgaggggcatctcgcgctggtccgt
cgcgcccgcgccgagaacgagaccgtcgtcgtcagcatcttcgtcaatcccttgcagttc
ggtcctcaggaagactacgaccgctacccgcgcgatctcgaccgcgacctgtacctcctc
gagcgcgagggtgtcgatgccgtcttcgctccctcggtgagtgagatgtatccatccggc
ttctccaccgcagtcgtggtgaccggcccgatcgccgagcgtctcgaaggggaagcccgg
cctggtcatttccgcggtgtcgccaccgtcgtgacgcgcctcttcgggctcgttcagcct
cagcgcgcctacttcggctggaaggatgcccagcaagtgctggtggttcagcggctggtc
caggacctcgcgctcccggtcgacatcgtgccgctccccactgtccgcgaggcagacggg
ttggccatgagcagtcgcaacgtctacctttcgcccgaggagcgagtcgcagccagcgcc
atcccgcgagcgttgttcgctgccctggagcgtttccgcagcggcgagcgcgcagccgca
gcgttccgcgaactcgtccagcgcacgctgaccaccacaccggtacgcctggaatacgtc
agcgtgagcgacttggagacgttccaggaagtcgagtacgtcgaacgcccggcgctcctg
ctcgtggctgcctggatcgggacgacccggctcatcgacaacgtgctgctcgatccggga
gcaccctga

DBGET integrated database retrieval system