KEGG   Thermotoga sp. RQ2: TRQ2_0038Help
Entry
TRQ2_0038         CDS       T00706                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
trq  Thermotoga sp. RQ2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TRQ2_0038
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TRQ2_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(33116..34228)
Genome map
AA seq 370 aa AA seqDB search
MILGATGSIGTQTLDVLKKVKGIRLIGISFHSNLELAFKIVKEFNVKNVAVTGDVEFEDS
SINVWKGPHSIEEMLEALKPDITMVAVSGFSGLRAVLSSLEHSKRVCLANKESLVCGGFL
VKKKLKEKRTELIPVDSEHSAIFQVIEPEVEKVVLTASGGALRDWEISKIDRARPEDVLR
HPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVLPDGNVK
MVVSPPDMRIPISYALFYPRRVALEPFFLRTISLSFEDPDPEKYPAFFLLKEIKDSYALR
TAFNAADEVAVEAFLKGRIRFGGIHRVIEKTLEEFQGYPQPRTLDDVERIHFEAIKKAER
VTEWLSSTSY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgatactgggtgccactggatccataggaactcagacactcgatgttttgaaaaaagtg
aagggaattcgattgataggcatctcgtttcacagcaatctggagctggccttcaagatc
gtgaaggaattcaacgtgaaaaacgtggcggtcacgggtgatgtggagttcgaagacagt
tcgatcaacgtctggaaaggtcctcattccatagaagagatgctggaagcgctgaagcct
gacatcacaatggtagcagtttcgggattcagtggattgagggcggtgctttcgtctctg
gagcactcgaaaagggtgtgccttgcaaacaaagaatctctcgtgtgcggcggatttctg
gtgaagaaaaaactcaaagagaaaagaactgaactcattccggtcgatagtgaacacagt
gccatctttcaggtgatagaaccagaagtggaaaaggtggttttgacagcttctggaggt
gctttgagagactgggagatttccaagatcgatagagcaagacctgaagacgtgctcagg
catcccgtgtggaatatgggagcccgtataacggtagattctgcaacaatggtgaacaag
gcgttcgaagttctggaagccatggagctcttcgagctgcccttcgagaagatagaagtg
aagatacacagagaggggctggttcacggagcggtggttttgcccgatggaaacgtcaaa
atggtggtatcaccaccggatatgagaataccgataagttatgctcttttctatccgaga
cgcgtcgctcttgaaccgttttttctgaggaccatcagcctttcttttgaagatcccgat
cccgaaaaataccctgcgttctttcttctgaaagagataaaggattcttacgctctgaga
acagctttcaacgcggcggacgaagtagcggtcgaagcctttctgaaagggagaataagg
ttcggtggtatccacagagtgatagagaaaactctcgaagagtttcaaggatatccacaa
ccgcgaacgctggatgatgtggagcgaattcatttcgaagcgataaaaaaagcggagagg
gtgacagaatggttatcgtctacttcatattga

DBGET integrated database retrieval system