KEGG   Thermotoga sp. RQ2: TRQ2_0175Help
Entry
TRQ2_0175         CDS       T00706                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
trq  Thermotoga sp. RQ2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:trq00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:trq00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:trq00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
170307..171716
Genome map
AA seq 469 aa AA seqDB search
MKISIIGAGSVRFALQLVGDIAQTEELSKGDTHVYLMDVHEKRLNASYTLAKKYVEELNS
PVKIVKTSSLDEAIDGADFIINTAYPYDPRYHDSGSQRWDEVTDVGERHGYYRGIDSQEL
NMVSTYTYVLSSYPDMKLALEIAEKMKKMAPRAYLMQTANPVFEITQAVRRWTGANIVGF
CHGVAGVYEVFERLGLDPKEVDWQVAGVNHGIWLNRFRYRGEDAYPLLDEWIEKELPKWE
PKNPWDTQMSPAAMDMYRFYGMLPIGDTVRNGTWKYHYNLETKKKWFGKFGGIDNEVERP
KFHEQLRRARERLIKLAEEVHPGMKLTEEHPEIFPKGKLSGEQHIPFINAIANNKRVRLF
LNVENQGTLKDFPDDLVMELPVWVDCCGIHREKVEPDLTHRIKIFYLWPRILRMEWNLEA
YISRDRKVLEEILIRDPRTKSYEQIVQVLDEIFNLPFNEELRRYYKEKL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctccatcatcggagcaggaagcgtgaggttcgcacttcagcttgtgggagat
atcgctcagaccgaagagctctcaaaaggagacacccatgtctacctcatggacgttcac
gaaaaaagactgaatgcatcttacactctcgcgaaaaagtacgtggaagagctgaactct
cctgtgaagatcgtaaaaacatccagtctggatgaagccatagatggagcagacttcatc
ataaacaccgcctatccttacgatccgaggtaccacgacagcggctctcagagatgggac
gaggtcacagatgtcggtgaaagacacggctactacagaggcatcgacagtcaggaactg
aacatggtttccacctacacctacgttctttcttcttatcccgacatgaagctcgccctc
gaaatcgcagagaagatgaagaagatggcacccagagcgtacttgatgcagacggcaaat
cccgtcttcgagatcacacaggcggtgagaaggtggaccggtgcgaacatagtggggttc
tgccacggagttgccggggtctacgaagtcttcgaaagactcggtctcgatccgaaggaa
gtggactggcaggtggcaggtgtgaaccacggtatctggttgaacaggttcagatacaga
ggagaagatgcctatcctctccttgatgagtggatagagaaagagctaccaaagtgggag
ccgaagaatccgtgggacacacagatgtctcctgccgcgatggacatgtacagattctac
ggtatgcttccgataggtgacaccgtgaggaacggtacctggaaataccattacaacctg
gagacgaagaagaagtggtttggaaagttcggtggcatagacaacgaagtggaaaggcca
aaattccacgaacagctcagaagagcaagagagcgcctcataaaactcgcagaagaggtc
catccaggcatgaaactcacagaagaacatcccgagatcttcccgaaagggaaactcagt
ggagaacagcacattcctttcataaacgcgatagcgaacaacaaacgtgtgagactcttc
ctgaacgtagagaaccagggaacgctcaaggactttcccgatgacctcgtgatggaactt
cccgtctgggtggactgctgtggaatccacagagagaaagtggaacccgatctcacccac
cggataaagatcttctatctgtggcccaggattctgagaatggagtggaacttagaagca
tacatctcgagggacagaaaggtgctcgaagagattctcatcagagacccaaggacaaaa
tcctacgagcagatcgtgcaagtgctcgatgagatcttcaacctgccgttcaacgaagag
ttgaggagatactacaaagagaaactctga

DBGET integrated database retrieval system