KEGG   Thermotoga sp. RQ2: TRQ2_0224Help
Entry
TRQ2_0224         CDS       T00706                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
trq  Thermotoga sp. RQ2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(219029..219982)
Genome map
AA seq 317 aa AA seqDB search
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LTLHVGYNAFSHISCSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaagctcttttggattcttaaaaagtacggtgtgagcgatcacatcgcgaag
gcttttctggaaataccccgtgaggagttcctgacgaagtcctacccactctcttacgtt
tacgaggatatcgttctggtttcctacgatgatggagaagaatacagcacttccagtcag
ccctctttgatggcgctgtttatggagtgggtgggtctggacaaaggaatgagagtcctc
gaaataggcggaggaacgggttacaacgctgccgtgatgagcagagttgtgggtgagaaa
ggccttgtggtctccgtggaatattcgaggaaaatctgcgagatcgcgaaaaggaacgtg
gaacgccttggaatagagaacgttatttttgtctgtggcgatggatactacggtgttccg
gagttttccccgtacgatgttatcttcgtaacagtcggtgtggatgaggtgccggagacg
tggttcactcaactcaaagaaggtgggagggtgatagtacctatcaatttgaaactttca
agaagacagcccgctttcctgttcaaaaaaaaggatccgtatcttgtgggaaactacaaa
ctggaaaccaggttcataacggcagggggcaatctcggaaatcttctcgagaggaacaga
aagcttttgagagaatttccattcaacagagagatcttactcgtacgttctcatatcttc
gtggagctggtggatctcctcaccaggagactcacagagattgatggaacgttctactac
gctgggccaaacggcgtggtagagtttctcgatgacaggatgagaatctacggggacgct
ccagagatagagaaccttttaactcagtgggaaagctgcggctacaggagcttcgaatat
ctcacgcttcatgtgggttacaacgctttttcacatatatcctgttctatttga

DBGET integrated database retrieval system