KEGG   Thermotoga sp. RQ2: TRQ2_0228Help
Entry
TRQ2_0228         CDS       T00706                                 

Definition
response regulator receiver protein
Orthology
K03413  
two-component system, chemotaxis family, response regulator CheY
Organism
trq  Thermotoga sp. RQ2
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:trq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TRQ2_0228
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TRQ2_0228
Two-component system [BR:trq02022]
 CheA family
  CheA-CheYBV
   TRQ2_0228
Bacterial motility proteins [BR:trq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TRQ2_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
223728..224090
Genome map
AA seq 120 aa AA seqDB search
MGKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEM
NGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVSK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagagagttttgatagtcgatgatgcagcgttcatgaggatgatgttgaaagat
atcatcacaaaagcgggatacgaagttgcaggggaagcaacaaacggtcgtgaagccgtt
gaaaaatacaaggaactcaaaccggacatcgtcacgatggacatcaccatgccggagatg
aacggtatcgatgcgatcaaagagatcatgaagatcgaccccaacgcaaagatcatcgtc
tgcagtgccatgggacagcaggcaatggtcatagaagctataaaagctggagcgaaagac
ttcattgtgaaacccttccagccttccagggtggtagaggctctcaacaaggtttcgaag
tga

DBGET integrated database retrieval system