KEGG   Thermotoga sp. RQ2: TRQ2_0239Help
Entry
TRQ2_0239         CDS       T00706                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TRQ2_0239
   01230 Biosynthesis of amino acids
    TRQ2_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0239
   00051 Fructose and mannose metabolism
    TRQ2_0239
   00562 Inositol phosphate metabolism
    TRQ2_0239
Enzymes [BR:trq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TRQ2_0239
Exosome [BR:trq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TRQ2_0239
  Exosomal proteins of bladder cancer cells
   TRQ2_0239
  Exosomal proteins of melanoma cells
   TRQ2_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(229907..230638)
Genome map
AA seq 243 aa AA seqDB search
MHKTIAEAKKFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQ
GAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDELINRKVKAVLEKGMTPILCVGETL
EEREKGLTFCVVEKQVREGFYGLDKEEAKKVVIAYEPVWAIGTGRVATPQQAQEVHAFIR
KLLSEMYDGETAESIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRG
VIS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacgatcgcggaagcgaaaaagtttgtgtcgctacttgtgaacgagcttcac
gacgtgaaagagttcgaaatagtggtctgtcccccgttcactgctctgtctgaagtaggg
gaaatactctcgggtaggaacatcaaattgggagctcaaaacgttttctacgaagaccag
ggagcgttcaccggggagatttctcctctcatgctgcaagagatcggcgttgaatacgtg
atcgtgggacattccgagagaaggcgcattttcaaagaagacgacgagctcataaacagg
aaagtgaaagcggtgcttgaaaaaggtatgactcctattctctgcgttggagaaacactc
gaggaaagagagaaaggactcactttctgtgttgtggaaaaacaggtgagagaaggtttc
tacggtctcgacaaagaggaagcaaagaaagtggtaatagcttacgagccagtctgggca
atcgggacaggaagggtggcgacaccacagcaagcacaggaagtacacgcgttcataaga
aagctgctctcggagatgtacgatggggaaacggctgaatcgataaggattctctatggt
ggaagcataaaaccggacaatttcctcggtctcattgttcagaaagatatagatggcggt
ctcgttggaggagcgagtctcaaagagtctttcatagaacttgcacgaataatgagaggt
gtgatttcctga

DBGET integrated database retrieval system