KEGG   Thermotoga sp. RQ2: TRQ2_0239Help
Entry
TRQ2_0239         CDS       T00706                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00010  Glycolysis / Gluconeogenesis
trq00051  Fructose and mannose metabolism
trq00562  Inositol phosphate metabolism
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01120  Microbial metabolism in diverse environments
trq01130  Biosynthesis of antibiotics
trq01200  Carbon metabolism
trq01230  Biosynthesis of amino acids
Module
trq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
trq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRQ2_0239
   00051 Fructose and mannose metabolism
    TRQ2_0239
   00562 Inositol phosphate metabolism
    TRQ2_0239
Enzymes [BR:trq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TRQ2_0239
Exosome [BR:trq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TRQ2_0239
  Exosomal proteins of bladder cancer cells
   TRQ2_0239
  Exosomal proteins of melanoma cells
   TRQ2_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB08599
UniProt: A0A0F6AJH9
Position
complement(229907..230638)
Genome map
AA seq 243 aa AA seqDB search
MHKTIAEAKKFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQ
GAFTGEISPLMLQEIGVEYVIVGHSERRRIFKEDDELINRKVKAVLEKGMTPILCVGETL
EEREKGLTFCVVEKQVREGFYGLDKEEAKKVVIAYEPVWAIGTGRVATPQQAQEVHAFIR
KLLSEMYDGETAESIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRG
VIS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacgatcgcggaagcgaaaaagtttgtgtcgctacttgtgaacgagcttcac
gacgtgaaagagttcgaaatagtggtctgtcccccgttcactgctctgtctgaagtaggg
gaaatactctcgggtaggaacatcaaattgggagctcaaaacgttttctacgaagaccag
ggagcgttcaccggggagatttctcctctcatgctgcaagagatcggcgttgaatacgtg
atcgtgggacattccgagagaaggcgcattttcaaagaagacgacgagctcataaacagg
aaagtgaaagcggtgcttgaaaaaggtatgactcctattctctgcgttggagaaacactc
gaggaaagagagaaaggactcactttctgtgttgtggaaaaacaggtgagagaaggtttc
tacggtctcgacaaagaggaagcaaagaaagtggtaatagcttacgagccagtctgggca
atcgggacaggaagggtggcgacaccacagcaagcacaggaagtacacgcgttcataaga
aagctgctctcggagatgtacgatggggaaacggctgaatcgataaggattctctatggt
ggaagcataaaaccggacaatttcctcggtctcattgttcagaaagatatagatggcggt
ctcgttggaggagcgagtctcaaagagtctttcatagaacttgcacgaataatgagaggt
gtgatttcctga

DBGET integrated database retrieval system